Result : EXP03478
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03478 |
| NCBI Accession ID | |
| Organism | Anaerobutyricum |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGCAGAGCATCTCGATGTTACAGAAGAATTTTTAAAAGATGCACTGGATGCATATCTCTTAAAATATGGAAAATGTACTGTAGTAGATAATTACATGGTATTTTTTGAACCATTAGGAGTTGTAGATATGAATTATGGAATTGAATAA |
| Sequence | MAEHLDVTEEFLKDALDAYLLKYGKCTVVDNYMVFFEPLGVVDMNYGIE |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 49 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2179291 | 2179431 | + | NZ_LR590481.1 | Hathewaya histolytica |
| 2 | 2455363 | 2455530 | + | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 3 | 1964967 | 1965110 | - | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 4 | 1437041 | 1437181 | - | NZ_CP028842.1 | Clostridium botulinum |
| 5 | 2767573 | 2767695 | + | NC_019897.1 | Thermobacillus composti KWC4 |
| 6 | 423808 | 423942 | - | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 7 | 2899392 | 2899550 | + | NC_014393.1 | Clostridium cellulovorans 743B |
| 8 | 5128462 | 5128590 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 9 | 191617 | 191760 | - | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 10 | 1103979 | 1104110 | - | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR027880.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13560.8 | 0.6 | 6 | 671.0 | same-strand | Helix-turn-helix domain |
| 2 | PF01381.24 | 0.8 | 8 | 352.5 | same-strand | Helix-turn-helix |
| 3 | PF13443.8 | 0.6 | 6 | 344 | same-strand | Cro/C1-type HTH DNA-binding domain |
++ More..