Result : EXP03475
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03475 |
| NCBI Accession ID | |
| Organism | Selenomonas |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGAGAAAATCGTCCTCCAGTGGGATGTCCAAACCGTTGAGGATACGGCTCGTGTAACTGCGATGTACTGTTTCAAGAATTGCAGCGTAAACGAAAATTAA |
| Sequence | MEKIVLQWDVQTVEDTARVTAMYCFKNCSVNEN |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 33 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1497385 | 1497486 | + | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 2 | 760837 | 760947 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 3 | 2095573 | 2095683 | + | NC_014033.1 | Prevotella ruminicola 23 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP012395.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04055.23 | 1.0 | 3 | 121 | same-strand | Radical SAM superfamily |
| 2 | PF13353.8 | 1.0 | 3 | 121 | same-strand | 4Fe-4S single cluster domain |
| 3 | PF00176.25 | 0.67 | 2 | 1441.5 | same-strand | SNF2-related domain |
| 4 | PF00271.33 | 1.0 | 3 | 1446 | same-strand | Helicase conserved C-terminal domain |
| 5 | PF05343.16 | 0.67 | 2 | 2647.5 | same-strand | M42 glutamyl aminopeptidase |
++ More..