Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized membrane protein YtzI |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 3136768 |
Right | 3136944 |
Strand | + |
Nucleotide Sequence | ATGCTACAATTGTTAAAAAACGGGAGGTGGAATGTCATGACGCTTCTCATTACGATAAGTATTTTGATTGTGCTGGCTGTTTTGCTTGTAACCATTTGGACGACTGTAAAAGCCTATAATGTAAAGCATACCATTGATCCACCACAAGAAAATCACTCTGATTCACACAATCAATGA |
Sequence | MLQLLKNGRWNVMTLLITISILIVLAVLLVTIWTTVKAYNVKHTIDPPQENHSDSHNQ |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of NF033232. Profile Description: YtzI protein. Members of this family include YtzI from Bacillus subtilis, and homologs widely distributed in the Firmicutes. The pattern of sequence conservation suggests the protein begins with a hydrophobic stretch without any basic residue near the initiator Met residue. Members of this family average about 53 residues in length. At the time this model was constructed, members were included in Pfam model PF12606.6 (Tumour necrosis factor receptor superfamily member 19), seemingly in error. This model was constructed to separate the two families. |
Pubmed ID | 9384377 |
Domain | CDD:380227 |
Functional Category | Others |
Uniprot ID | C0H3Q1 |
ORF Length (Amino Acid) | 58 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3136768 | 3136944 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 2940468 | 2940644 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
3 | 2942066 | 2942242 | + | NZ_CP048852.1 | Bacillus tequilensis |
4 | 3016104 | 3016280 | + | NZ_CP013984.1 | Bacillus inaquosorum |
5 | 3009978 | 3010154 | + | NZ_CP033052.1 | Bacillus vallismortis |
6 | 3157355 | 3157537 | - | NZ_CP029364.1 | Bacillus halotolerans |
7 | 2930942 | 2931124 | + | NZ_CP051464.1 | Bacillus mojavensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00005.29 | 0.86 | 6 | 2599.5 | same-strand | ABC transporter |
2 | PF00528.24 | 0.86 | 6 | 1812.5 | same-strand | Binding-protein-dependent transport system inner membrane component |
3 | PF05105.14 | 1.0 | 7 | 699 | opposite-strand | Bacteriophage holin family |
4 | PF00210.26 | 1.0 | 7 | 95 | opposite-strand | Ferritin-like domain |
5 | PF19174.2 | 1.0 | 7 | 95 | opposite-strand | Family of unknown function (DUF5856) |
6 | PF13115.8 | 1.0 | 7 | -6 | opposite-strand | YtkA-like |
7 | PF02664.17 | 1.0 | 7 | 554 | opposite-strand | S-Ribosylhomocysteinase (LuxS) |
8 | PF00484.21 | 1.0 | 7 | 1379 | opposite-strand | Carbonic anhydrase |
9 | PF01197.20 | 1.0 | 7 | 2059 | opposite-strand | Ribosomal protein L31 |
10 | PF01654.19 | 1.0 | 7 | 2513 | same-strand | Cytochrome bd terminal oxidase subunit I |