Result : EXP03467

Protein Information

• Protein name: EXP03467
• Organism: Catabacter,Oscillibacter,Mordavella,Collinsella
• Nucleotide Sequence: ATGAAGAAGCTTAGCCCGCCGCGTGCGCTTTTGACGGTAGCGCTGCTTTTAACAGCCGCTTTCCTGATTTGCTTTGGCCTTATGCGCGGCGAGTTTATGCGAGTATTATCCAAGGCGGCGTCAATTTGCCTTGAATGTATCGGAATCGGGTGA
• Sequence: MKKLSPPRALLTVALLLTAAFLICFGLMRGEFMRVLSKAASICLECIGIG
• Source of smORF: Metagenomic Ribo-seq
• Pubmed ID: 32601270
• Functional Category: Function not yet assigned
• ORF Length (Amino Acid): 50

Conservation Analysis

No. of Species: 9

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	1635433	1635558	-	NZ_AP019367.1	Parolsenella catena
2	972545	972670	-	NC_013204.1	Eggerthella lenta DSM 2243
3	4562046	4562171	-	NZ_CP039126.1	Blautia producta
4	1930653	1930799	-	NZ_CP029256.1	Christensenella minuta
5	1114379	1114516	+	NZ_CP014176.1	Clostridium argentinense
6	782234	782371	-	NZ_CP007453.1	Peptoclostridium acidaminophilum DSM 3953
7	350311	350448	-	NZ_LT635772.1	Anaerococcus mediterraneensis
8	446121	446267	+	NZ_LR134524.1	Peptoniphilus harei
9	1946548	1946694	+	NZ_LT990039.1	Massilistercora timonensis

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_AP019367.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00578.23	0.78	7	925	same-strand	AhpC/TSA family
2	PF08534.12	0.89	8	897.5	same-strand	Redoxin
3	PF13905.8	0.78	7	870	same-strand	Thioredoxin-like
4	PF12801.9	0.67	6	-7.0	same-strand	4Fe-4S binding domain