Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YtzJ |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 2995699 |
Right | 2995890 |
Strand | + |
Nucleotide Sequence | ATGGAGGTTTACAGTGACCGTCAGTTAGCAAAAGATCAAGCAGCCCGTCTCAGACAAGGTTTTTCTGCATATGCCGAAACAAACTCACTCGCTTCCCTCATCAAAAAAGAACTTCAATCACACAATCTCCAAGTCTACGAGGACCTTACTGATTTCGGCTGCTGGTTCATCCCCGTCACAGATGAACACTAA |
Sequence | MEVYSDRQLAKDQAARLRQGFSAYAETNSLASLIKKELQSHNLQVYEDLTDFGCWFIPVTDEH |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | C0H3P9 |
ORF Length (Amino Acid) | 63 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2878849 | 2879040 | + | NZ_CP033052.1 | Bacillus vallismortis |
2 | 2995699 | 2995890 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
3 | 2801084 | 2801275 | + | NZ_CP051464.1 | Bacillus mojavensis |
4 | 3298519 | 3298710 | - | NZ_CP029364.1 | Bacillus halotolerans |
5 | 2812861 | 2813052 | + | NZ_CP048852.1 | Bacillus tequilensis |
6 | 2808830 | 2809021 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
7 | 2874667 | 2874858 | + | NZ_CP013984.1 | Bacillus inaquosorum |
8 | 1151580 | 1151771 | - | NZ_CP011937.1 | Bacillus velezensis |
9 | 2834964 | 2835155 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
10 | 2781806 | 2781991 | - | NZ_CP017786.1 | Bacillus xiamenensis |
11 | 2611157 | 2611342 | + | NZ_CP011150.1 | Bacillus altitudinis |
12 | 2689553 | 2689738 | - | NZ_CP043404.1 | Bacillus safensis |
13 | 3338049 | 3338228 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
14 | 2963553 | 2963732 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
15 | 3150740 | 3150919 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
16 | 1015605 | 1015793 | - | NZ_CP016020.1 | Bacillus weihaiensis |
17 | 3019323 | 3019508 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF17848.3 | 0.88 | 15 | 6133 | opposite-strand | Acetyl-coA carboxylase zinc finger domain |
2 | PF00390.21 | 0.88 | 15 | 4567 | opposite-strand | Malic enzyme, N-terminal domain |
3 | PF03949.17 | 1.0 | 17 | 4567 | opposite-strand | Malic enzyme, NAD binding domain |
4 | PF07733.14 | 1.0 | 17 | 1088 | opposite-strand | Bacterial DNA polymerase III alpha NTPase domain |
5 | PF17657.3 | 1.0 | 17 | 1088 | opposite-strand | Bacterial DNA polymerase III alpha subunit finger domain |
6 | PF02811.21 | 1.0 | 17 | 1088 | opposite-strand | PHP domain |
7 | PF14579.8 | 1.0 | 17 | 1088 | opposite-strand | Helix-hairpin-helix motif |
8 | PF01336.27 | 1.0 | 17 | 1088 | opposite-strand | OB-fold nucleic acid binding domain |
9 | PF14034.8 | 1.0 | 17 | 606 | same-strand | Sporulation protein YtrH |
10 | PF02272.21 | 1.0 | 17 | 18 | opposite-strand | DHHA1 domain |
11 | PF01368.22 | 1.0 | 17 | 18 | opposite-strand | DHH family |
12 | PF14007.8 | 1.0 | 17 | 1090 | same-strand | YtpI-like protein |
13 | PF07085.14 | 1.0 | 17 | 1412 | opposite-strand | DRTGG domain |
14 | PF00571.30 | 1.0 | 17 | 1412 | opposite-strand | CBS domain |
15 | PF03061.24 | 1.0 | 17 | 1412 | opposite-strand | Thioesterase superfamily |
16 | PF13483.8 | 0.76 | 13 | 2948 | opposite-strand | Beta-lactamase superfamily domain |
17 | PF12706.9 | 0.76 | 13 | 2948 | opposite-strand | Beta-lactamase superfamily domain |
18 | PF00753.29 | 0.76 | 13 | 2948 | opposite-strand | Metallo-beta-lactamase superfamily |