Result : C0H3P9

Protein Information

• Protein name: Uncharacterized protein YtzJ
• NCBI Accession ID: AL009126.3
• Organism: Bacillus subtilis (strain 168)
• Left: 2995699
• Right: 2995890
• Strand: +
• Nucleotide Sequence: ATGGAGGTTTACAGTGACCGTCAGTTAGCAAAAGATCAAGCAGCCCGTCTCAGACAAGGTTTTTCTGCATATGCCGAAACAAACTCACTCGCTTCCCTCATCAAAAAAGAACTTCAATCACACAATCTCCAAGTCTACGAGGACCTTACTGATTTCGGCTGCTGGTTCATCCCCGTCACAGATGAACACTAA
• Sequence: MEVYSDRQLAKDQAARLRQGFSAYAETNSLASLIKKELQSHNLQVYEDLTDFGCWFIPVTDEH
• Source of smORF: Swiss-Prot
• Pubmed ID: 9384377
• Functional Category: Others
• Uniprot ID: C0H3P9
• ORF Length (Amino Acid): 63

Conservation Analysis

No. of Species: 17

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	2878849	2879040	+	NZ_CP033052.1	Bacillus vallismortis
2	2995699	2995890	+	NC_000964.3	Bacillus subtilis subsp. subtilis str. 168
3	2801084	2801275	+	NZ_CP051464.1	Bacillus mojavensis
4	3298519	3298710	-	NZ_CP029364.1	Bacillus halotolerans
5	2812861	2813052	+	NZ_CP048852.1	Bacillus tequilensis
6	2808830	2809021	+	NZ_CP034943.1	Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499
7	2874667	2874858	+	NZ_CP013984.1	Bacillus inaquosorum
8	1151580	1151771	-	NZ_CP011937.1	Bacillus velezensis
9	2834964	2835155	+	NZ_CP053376.1	Bacillus amyloliquefaciens
10	2781806	2781991	-	NZ_CP017786.1	Bacillus xiamenensis
11	2611157	2611342	+	NZ_CP011150.1	Bacillus altitudinis
12	2689553	2689738	-	NZ_CP043404.1	Bacillus safensis
13	3338049	3338228	+	NZ_LT603683.1	Bacillus glycinifermentans
14	2963553	2963732	+	NC_006270.3	Bacillus licheniformis DSM 13 = ATCC 14580
15	3150740	3150919	+	NZ_CP023665.1	Bacillus paralicheniformis
16	1015605	1015793	-	NZ_CP016020.1	Bacillus weihaiensis
17	3019323	3019508	+	NZ_CP015378.1	Fictibacillus phosphorivorans

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_CP033052.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF17848.3	0.88	15	6133	opposite-strand	Acetyl-coA carboxylase zinc finger domain
2	PF00390.21	0.88	15	4567	opposite-strand	Malic enzyme, N-terminal domain
3	PF03949.17	1.0	17	4567	opposite-strand	Malic enzyme, NAD binding domain
4	PF07733.14	1.0	17	1088	opposite-strand	Bacterial DNA polymerase III alpha NTPase domain
5	PF17657.3	1.0	17	1088	opposite-strand	Bacterial DNA polymerase III alpha subunit finger domain
6	PF02811.21	1.0	17	1088	opposite-strand	PHP domain
7	PF14579.8	1.0	17	1088	opposite-strand	Helix-hairpin-helix motif
8	PF01336.27	1.0	17	1088	opposite-strand	OB-fold nucleic acid binding domain
9	PF14034.8	1.0	17	606	same-strand	Sporulation protein YtrH
10	PF02272.21	1.0	17	18	opposite-strand	DHHA1 domain
11	PF01368.22	1.0	17	18	opposite-strand	DHH family
12	PF14007.8	1.0	17	1090	same-strand	YtpI-like protein
13	PF07085.14	1.0	17	1412	opposite-strand	DRTGG domain
14	PF00571.30	1.0	17	1412	opposite-strand	CBS domain
15	PF03061.24	1.0	17	1412	opposite-strand	Thioesterase superfamily
16	PF13483.8	0.76	13	2948	opposite-strand	Beta-lactamase superfamily domain
17	PF12706.9	0.76	13	2948	opposite-strand	Beta-lactamase superfamily domain
18	PF00753.29	0.76	13	2948	opposite-strand	Metallo-beta-lactamase superfamily