Result : EXP03454
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03454 |
| NCBI Accession ID | |
| Organism | Leptotrichia |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGAAAGAAAGTGGATTGTTAACTAGAGCATTGATGATTGTTGATGAAAATAATGTTGTTAAGTATATTGAATATGTGCCAGAACAAGGTAAGGAAGCTAATGTTGACAAGGCATTGAAATTCTTACAAGAAAAAATGTTAAAAAAATAA |
| Sequence | MKESGLLTRALMIVDENNVVKYIEYVPEQGKEANVDKALKFLQEKMLKK |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 49 |
++ More..
| Conservation Analysis |
No. of Species: 11
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1253056 | 1253187 | - | NZ_AP019829.2 | Leptotrichia wadei |
| 2 | 1253992 | 1254123 | - | NZ_AP019829.2 | Leptotrichia wadei |
| 3 | 1154389 | 1154520 | - | NZ_AP019827.1 | Leptotrichia shahii |
| 4 | 389737 | 389895 | + | NZ_AP019822.1 | Pseudoleptotrichia goodfellowii |
| 5 | 2380178 | 2380318 | + | NZ_CP035108.1 | Geovibrio thiophilus |
| 6 | 1632262 | 1632387 | - | NZ_CP041345.1 | Tenuifilum thalassicum |
| 7 | 1688308 | 1688445 | - | NZ_CP011366.1 | Salinicoccus halodurans |
| 8 | 207892 | 208032 | - | NZ_LR134524.1 | Peptoniphilus harei |
| 9 | 447623 | 447775 | - | NZ_CP053187.1 | Turicibacter sanguinis |
| 10 | 362665 | 362793 | + | NZ_CP063145.1 | Cruoricaptor ignavus |
| 11 | 1104195 | 1104323 | - | NZ_CP033926.1 | Chryseobacterium joostei |
| 12 | 187176 | 187301 | + | NZ_LR134441.1 | Kaistella antarctica |
++ More..