Result : B9MKA5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Translational regulator CsrA |
| NCBI Accession ID | CP001393.1 |
| Organism | Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) (Anaerocellum thermophilum) |
| Left | 1762755 |
| Right | 1762991 |
| Strand | - |
| Nucleotide Sequence | ATGCTTGTTCTTTCACGAAAAGAAGGAGACCAAATTTTAATTGGAGATGATATAATAATAAAAGTCATCAGCATAGAAAAGGACTGTGTAAAACTTGGAATAGATGCCCCAAAAAATATAAAGGTTTTACGATATGAGCTACTTCAAGAAGTCAAAAACGAAAATGTCGAAGCGTTGCAGGGTAAAGAGAGGCTTATTAGAATCAAGGATTTGAAAGGGCTTTTCAAAGATGGTTAA |
| Sequence | MLVLSRKEGDQILIGDDIIIKVISIEKDCVKLGIDAPKNIKVLRYELLQEVKNENVEALQGKERLIRIKDLKGLFKDG |
| Source of smORF | Swiss-Prot |
| Function | A translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Usually binds in the 5'-UTR at or near the Shine-Dalgarno sequence preventing ribosome-binding, thus repressing translation. Its main target seems to be the major flagellin gene, while its function is anatagonized by FliW. {ECO:0000255|HAMAP-Rule:MF_00167}. |
| Pubmed ID | |
| Domain | CDD:412510 |
| Functional Category | RNA-binding |
| Uniprot ID | B9MKA5 |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 22
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1762755 | 1762991 | - | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 2 | 1824022 | 1824264 | + | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 3 | 1028782 | 1029024 | + | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 4 | 1498873 | 1499115 | - | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 5 | 1201430 | 1201672 | + | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 6 | 1094319 | 1094561 | + | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 7 | 1159960 | 1160202 | - | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 8 | 1622090 | 1622332 | - | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 9 | 1758552 | 1758794 | - | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 10 | 431457 | 431708 | - | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 11 | 441635 | 441865 | + | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 12 | 2634902 | 2635144 | + | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 13 | 3487544 | 3487771 | - | NZ_LS483476.1 | Lederbergia lentus |
| 14 | 476799 | 477020 | - | NC_011653.1 | Thermosipho africanus TCF52B |
| 15 | 2636505 | 2636720 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 16 | 1835029 | 1835244 | - | NZ_HG917868.1 | Clostridium bornimense |
| 17 | 1755702 | 1755938 | - | NZ_CP011058.1 | Paenibacillus beijingensis |
| 18 | 587099 | 587326 | + | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 19 | 2512853 | 2513071 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 20 | 519833 | 520060 | + | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 21 | 804094 | 804321 | - | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 22 | 1815913 | 1816140 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_012034.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00669.22 | 0.73 | 16 | 1085.0 | same-strand | Bacterial flagellin N-terminal helical region |
| 2 | PF00700.23 | 0.73 | 16 | 1085.0 | same-strand | Bacterial flagellin C-terminal helical region |
| 3 | PF02623.17 | 0.86 | 19 | 11 | same-strand | FliW protein |
++ More..