Protein Information |
Information Type | Description |
---|---|
Protein name | Translational regulator CsrA |
NCBI Accession ID | CP001393.1 |
Organism | Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) (Anaerocellum thermophilum) |
Left | 1762755 |
Right | 1762991 |
Strand | - |
Nucleotide Sequence | ATGCTTGTTCTTTCACGAAAAGAAGGAGACCAAATTTTAATTGGAGATGATATAATAATAAAAGTCATCAGCATAGAAAAGGACTGTGTAAAACTTGGAATAGATGCCCCAAAAAATATAAAGGTTTTACGATATGAGCTACTTCAAGAAGTCAAAAACGAAAATGTCGAAGCGTTGCAGGGTAAAGAGAGGCTTATTAGAATCAAGGATTTGAAAGGGCTTTTCAAAGATGGTTAA |
Sequence | MLVLSRKEGDQILIGDDIIIKVISIEKDCVKLGIDAPKNIKVLRYELLQEVKNENVEALQGKERLIRIKDLKGLFKDG |
Source of smORF | Swiss-Prot |
Function | A translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Usually binds in the 5'-UTR at or near the Shine-Dalgarno sequence preventing ribosome-binding, thus repressing translation. Its main target seems to be the major flagellin gene, while its function is anatagonized by FliW. {ECO:0000255|HAMAP-Rule:MF_00167}. |
Pubmed ID | |
Domain | CDD:412510 |
Functional Category | RNA-binding |
Uniprot ID | B9MKA5 |
ORF Length (Amino Acid) | 78 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1762755 | 1762991 | - | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
2 | 1824022 | 1824264 | + | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
3 | 1028782 | 1029024 | + | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
4 | 1498873 | 1499115 | - | NC_014657.1 | Caldicellulosiruptor owensensis OL |
5 | 1201430 | 1201672 | + | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
6 | 1094319 | 1094561 | + | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
7 | 1159960 | 1160202 | - | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
8 | 1622090 | 1622332 | - | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
9 | 1758552 | 1758794 | - | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
10 | 431457 | 431708 | - | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
11 | 441635 | 441865 | + | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
12 | 2634902 | 2635144 | + | NC_009253.1 | Desulfotomaculum reducens MI-1 |
13 | 3487544 | 3487771 | - | NZ_LS483476.1 | Lederbergia lentus |
14 | 476799 | 477020 | - | NC_011653.1 | Thermosipho africanus TCF52B |
15 | 2636505 | 2636720 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
16 | 1835029 | 1835244 | - | NZ_HG917868.1 | Clostridium bornimense |
17 | 1755702 | 1755938 | - | NZ_CP011058.1 | Paenibacillus beijingensis |
18 | 587099 | 587326 | + | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
19 | 2512853 | 2513071 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
20 | 519833 | 520060 | + | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
21 | 804094 | 804321 | - | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
22 | 1815913 | 1816140 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00669.22 | 0.73 | 16 | 1085.0 | same-strand | Bacterial flagellin N-terminal helical region |
2 | PF00700.23 | 0.73 | 16 | 1085.0 | same-strand | Bacterial flagellin C-terminal helical region |
3 | PF02623.17 | 0.86 | 19 | 11 | same-strand | FliW protein |