Result : EXP03411
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03411 |
| NCBI Accession ID | |
| Organism | Clostridium |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGAAAAAGGAGGCAGCACAGATGAAGGTAGTGGTCATCAAAAGCCCAAAATTTCTCTCCGGCATTTTGAGGATGATCTTTAAAATCAATAAGGACGAAGAATAA |
| Sequence | MKKEAAQMKVVVIKSPKFLSGILRMIFKINKDEE |
| Source of smORF | Metagenomic Ribo-seq |
| Function | The ORF matches to the profile of cl26797. Profile Description: Stage V sporulation protein family. Members of this family are SpoVM (stage V sporulation protein M). |
| Pubmed ID | 32601270 |
| Domain | CDD:391612 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 34 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2078734 | 2078832 | + | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
| 2 | 2254899 | 2254985 | - | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 3 | 1411344 | 1411430 | + | NZ_CP030777.1 | Faecalibacterium prausnitzii |
| 4 | 2320768 | 2320869 | - | NZ_CP048436.1 | Flavonifractor plautii |
| 5 | 2391003 | 2391098 | - | NZ_CP016020.1 | Bacillus weihaiensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_014833.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04055.23 | 0.6 | 3 | 4550 | same-strand | Radical SAM superfamily |
| 2 | PF13672.8 | 0.8 | 4 | 3832.5 | same-strand | Protein phosphatase 2C |
| 3 | PF00069.27 | 1.0 | 5 | 1724 | same-strand | Protein kinase domain |
| 4 | PF07714.19 | 1.0 | 5 | 1724 | same-strand | Protein tyrosine and serine/threonine kinase |
| 5 | PF03793.21 | 1.0 | 5 | 1724 | same-strand | PASTA domain |
| 6 | PF03193.18 | 1.0 | 5 | 843 | same-strand | RsgA GTPase |
| 7 | PF16745.7 | 1.0 | 5 | 843 | same-strand | RsgA N-terminal domain |
| 8 | PF04263.18 | 1.0 | 5 | 137 | same-strand | Thiamin pyrophosphokinase, catalytic domain |
| 9 | PF04265.16 | 0.8 | 4 | 101.5 | same-strand | Thiamin pyrophosphokinase, vitamin B1 binding domain |
++ More..