Result : B9LA90
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cell division topological specificity factor |
| NCBI Accession ID | CP001279.1 |
| Organism | Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) |
| Left | 1067810 |
| Right | 1068043 |
| Strand | + |
| Nucleotide Sequence | ATGAGTTTTTTTGACATATTCAAAAAGAAAAAATCAAAAGACGTGGCAAAAGATAGACTTATGATGATGCTCGCTTATGAAAGAGCAAATACAAAAATAGAAAACTTGGATGAAATGAAAAAAGATTTAATCAATGTGGTAAAAAAATATTTAAACGTTAAAGACGTACATATTAAATCAAATTCAAACCAAGATATTGAAACTTTAGAAGTGGAAATAATTCTTAACAAATGA |
| Sequence | MSFFDIFKKKKSKDVAKDRLMMMLAYERANTKIENLDEMKKDLINVVKKYLNVKDVHIKSNSNQDIETLEVEIILNK |
| Source of smORF | Swiss-Prot |
| Function | Prevents the cell division inhibition by proteins MinC and MinD at internal division sites while permitting inhibition at polar sites. This ensures cell division at the proper site by restricting the formation of a division septum at the midpoint of the long axis of the cell. {ECO:0000255|HAMAP-Rule:MF_00262}. |
| Pubmed ID | 19197347 |
| Domain | CDD:412433 |
| Functional Category | Others |
| Uniprot ID | B9LA90 |
| ORF Length (Amino Acid) | 77 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1067810 | 1068043 | + | NC_012115.1 | Nautilia profundicola AmH |
| 2 | 527152 | 527385 | - | NZ_CP027432.2 | Caminibacter pacificus |
| 3 | 1378555 | 1378788 | + | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
| 4 | 902119 | 902358 | + | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 5 | 1082238 | 1082477 | + | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 6 | 868590 | 868829 | + | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 7 | 1159460 | 1159699 | + | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 8 | 1700108 | 1700347 | - | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 9 | 1250056 | 1250286 | + | NZ_LS483446.1 | Helicobacter mustelae |
| 10 | 332849 | 333082 | - | NZ_CP063087.1 | Helicobacter winghamensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_012115.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07991.14 | 0.8 | 8 | 876.0 | same-strand | Acetohydroxy acid isomeroreductase, NADPH-binding domain |
| 2 | PF01450.21 | 0.8 | 8 | 876.0 | same-strand | Acetohydroxy acid isomeroreductase, catalytic domain |
| 3 | PF03807.19 | 0.8 | 8 | 878 | same-strand | NADP oxidoreductase coenzyme F420-dependent |
| 4 | PF13614.8 | 1.0 | 10 | -3.0 | same-strand | AAA domain |
| 5 | PF01656.25 | 1.0 | 10 | -3.0 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 6 | PF10609.11 | 1.0 | 10 | -3.0 | same-strand | NUBPL iron-transfer P-loop NTPase |
| 7 | PF04748.15 | 0.9 | 9 | 9 | same-strand | Divergent polysaccharide deacetylase |
| 8 | PF02481.17 | 1.0 | 10 | 1145.0 | same-strand | DNA recombination-mediator protein A |
| 9 | PF03652.17 | 0.6 | 6 | 2289.5 | same-strand | Holliday junction resolvase |
++ More..