Result : EXP03382
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03382 |
| NCBI Accession ID | |
| Organism | Ruminococcus |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGAGTATTGTTGATTTTATAGCAGTAGTGAGCTTCGGCTTAACCTGCTTTGGTCTTGGATATACCTTTGGCAAGGATAATACTAAATTAACTGTGGCATACCATTGA |
| Sequence | MSIVDFIAVVSFGLTCFGLGYTFGKDNTKLTVAYH |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 35 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1515906 | 1516004 | + | NZ_CP070062.1 | Coprococcus comes |
| 2 | 1532483 | 1532581 | + | NZ_CP070062.1 | Coprococcus comes |
| 3 | 1951413 | 1951511 | + | NZ_CP070062.1 | Coprococcus comes |
| 4 | 1463304 | 1463402 | - | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP070062.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09413.12 | 1.0 | 2 | 114 | opposite-strand | Putative prokaryotic signal transducing protein |
++ More..