Result : EXP03379
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03379 |
| NCBI Accession ID | |
| Organism | |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGCAGCATAGATTTAGGGGTATAGCTCAGTTGGTAGAGCAGCGGTCTCCAAAACCGCGTGTCGAGAGTTCGAGTCTTTCTGCCCCTGCCATAAAAAAATACTTTACAAGTCCGTTTGTAAATGTTATAATAAATCTGTTCTTTGATTAG |
| Sequence | MQHRFRGIAQLVEQRSPKPRVESSSLSAPAIKKYFTSPFVNVIINLFFD |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 49 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1952772 | 1952921 | - | NZ_CP065728.1 | Moraxella nonliquefaciens |
| 2 | 4334622 | 4334759 | + | NZ_CP019038.1 | Massilia putida |
| 3 | 3200530 | 3200658 | - | NC_010622.1 | Paraburkholderia phymatum STM815 |
| 4 | 4038691 | 4038813 | + | NZ_LT906459.1 | Odoribacter splanchnicus |
| 5 | 1254540 | 1254671 | - | NC_007940.1 | Rickettsia bellii RML369-C |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_010622.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00466.22 | 0.6 | 3 | 2532 | same-strand | Ribosomal protein L10 |
| 2 | PF00687.23 | 0.8 | 4 | 1596.0 | same-strand | Ribosomal protein L1p/L10e family |
| 3 | PF03946.16 | 0.6 | 3 | 1098 | same-strand | Ribosomal protein L11, N-terminal domain |
| 4 | PF00298.21 | 0.8 | 4 | 1213.5 | same-strand | Ribosomal protein L11, RNA binding domain |
| 5 | PF02357.21 | 0.8 | 4 | 390.5 | same-strand | Transcription termination factor nusG |
| 6 | PF00467.31 | 0.8 | 4 | 390.5 | same-strand | KOW motif |
| 7 | PF00584.22 | 0.8 | 4 | 12.0 | same-strand | SecE/Sec61-gamma subunits of protein translocation complex |
| 8 | PF00009.29 | 0.6 | 3 | 65 | same-strand | Elongation factor Tu GTP binding domain |
| 9 | PF03144.27 | 0.6 | 3 | 65 | same-strand | Elongation factor Tu domain 2 |
| 10 | PF01926.25 | 0.6 | 3 | 65 | same-strand | 50S ribosome-binding GTPase |
++ More..