Result : EXP03375
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03375 |
| NCBI Accession ID | |
| Organism | Campylobacter |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGCTAGGCATAATAGAAAAAGCCATTATCCTGCTAATAGTCGTCGCAGGCGCCATTTGTGCCTGGTCAGTACTTACGCCAAATCACCTATTTGTAGGTTNANNTTGA |
| Sequence | MLGIIEKAIILLIVVAGAICAWSVLTPNHLFVGXX |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 35 |
++ More..
| Conservation Analysis |
No. of Species: 21
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 304672 | 304773 | + | NZ_CP012541.1 | Campylobacter concisus |
| 2 | 353635 | 353733 | + | NZ_CP053831.1 | Campylobacter mucosalis |
| 3 | 264222 | 264323 | - | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 4 | 110692 | 110793 | - | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 5 | 1587624 | 1587725 | - | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 6 | 1020117 | 1020218 | + | NZ_CP063079.1 | Campylobacter peloridis |
| 7 | 380940 | 381041 | + | NZ_CP012543.1 | Campylobacter rectus |
| 8 | 344898 | 344999 | + | NZ_CP053825.1 | Campylobacter armoricus |
| 9 | 360925 | 361026 | + | NZ_CP053848.1 | Campylobacter ornithocola |
| 10 | 282727 | 282828 | + | NZ_CP053826.1 | Campylobacter curvus |
| 11 | 2563207 | 2563296 | - | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 12 | 2403327 | 2403416 | - | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 13 | 351707 | 351808 | + | NC_012039.1 | Campylobacter lari RM2100 |
| 14 | 339016 | 339117 | + | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 15 | 337321 | 337422 | + | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 16 | 455662 | 455751 | + | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 17 | 784832 | 784933 | - | NZ_CP031611.1 | Campylobacter hepaticus |
| 18 | 1422130 | 1422231 | - | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 19 | 311364 | 311465 | + | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 20 | 366436 | 366537 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 21 | 1764676 | 1764777 | - | NZ_CP012544.1 | Campylobacter showae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP053831.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00115.22 | 1.0 | 21 | 1982 | same-strand | Cytochrome C and Quinol oxidase polypeptide I |
| 2 | PF02433.17 | 1.0 | 21 | 1305 | same-strand | Cytochrome C oxidase, mono-heme subunit/FixO |
| 3 | PF05545.13 | 1.0 | 21 | 1093 | same-strand | Cbb3-type cytochrome oxidase component FixQ |
| 4 | PF14715.8 | 1.0 | 21 | 215 | same-strand | N-terminal domain of cytochrome oxidase-cbb3, FixP |
| 5 | PF13442.8 | 1.0 | 21 | 215 | same-strand | Cytochrome C oxidase, cbb3-type, subunit III |
| 6 | PF13179.8 | 1.0 | 21 | 3 | same-strand | Family of unknown function (DUF4006) |
| 7 | PF05751.13 | 0.9 | 19 | 580 | same-strand | FixH |
| 8 | PF12705.9 | 0.86 | 18 | 1095.0 | same-strand | PD-(D/E)XK nuclease superfamily |
| 9 | PF00580.23 | 1.0 | 21 | 3469 | same-strand | UvrD/REP helicase N-terminal domain |
| 10 | PF13245.8 | 1.0 | 21 | 3469 | same-strand | AAA domain |
| 11 | PF00572.20 | 0.67 | 14 | 6377.5 | same-strand | Ribosomal protein L13 |
++ More..