Protein Information |
Information Type | Description |
---|---|
Protein name | EXP03367 |
NCBI Accession ID | |
Organism | Sutterella |
Left | |
Right | |
Strand | |
Nucleotide Sequence | ATGTTCTACATTTATTGGTTTGTCGGGTTGCTTTTAGCGATTGTCTTCGCTGTTTTGATGGCAGCCATGTATGAGCTCAAAAATGACGACGCTTCGCAAGAAAAATAA |
Sequence | MFYIYWFVGLLLAIVFAVLMAAMYELKNDDASQEK |
Source of smORF | Metagenomic Ribo-seq |
Function | |
Pubmed ID | 32601270 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 35 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1299409 | 1299519 | + | NZ_CP006880.1 | Rhizobium gallicum bv. gallicum R602sp |
2 | 720955 | 721077 | + | NZ_CP013536.1 | Rhizobium phaseoli |
3 | 203249 | 203359 | - | NZ_CP019937.1 | Ketogulonicigenium robustum |
4 | 119435 | 119557 | - | NZ_CP071611.1 | Rhizobium binae |
5 | 248120 | 248242 | + | NZ_CP035002.1 | Rhizobium acidisoli |
6 | 204734 | 204841 | - | NC_017957.2 | Tistrella mobilis KA081020-065 |
7 | 341901 | 342023 | - | NZ_CP071681.1 | Rhizobium ruizarguesonis |
8 | 2685179 | 2685277 | + | NZ_CP046908.1 | Stappia indica |
9 | 248659 | 248781 | + | NZ_CP013504.1 | Rhizobium esperanzae |
10 | 355256 | 355378 | + | NZ_LT671418.1 | Herminiimonas arsenitoxidans |
11 | 652778 | 652897 | + | NC_009937.1 | Azorhizobium caulinodans ORS 571 |
12 | 90640 | 90762 | - | NZ_CP054025.1 | Rhizobium indicum |
13 | 107785 | 107907 | + | NZ_CP071455.1 | Rhizobium lentis |
14 | 1591642 | 1591764 | - | NZ_CP054028.1 | Rhizobium hidalgonense |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF12802.9 | 0.71 | 10 | 6261.0 | same-strand | MarR family |
2 | PF01022.22 | 0.64 | 9 | 6257 | same-strand | Bacterial regulatory protein, arsR family |
3 | PF00005.29 | 1.0 | 14 | 2884.5 | same-strand | ABC transporter |
4 | PF01654.19 | 1.0 | 14 | 1175.0 | same-strand | Cytochrome bd terminal oxidase subunit I |
5 | PF02322.17 | 1.0 | 14 | 14.5 | same-strand | Cytochrome bd terminal oxidase subunit II |