Protein Information |
Information Type | Description |
---|---|
Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
NCBI Accession ID | CP001279.1 |
Organism | Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) |
Left | 455162 |
Right | 455365 |
Strand | - |
Nucleotide Sequence | ATGAGAATAGAACAGATTAACGCAAGAGCACTTGAAAAAGTAAACTACGACAGATATCTTTTGAGCCAGGCAATAGCTAAAAGAGTAAATGAACTGATTAACGGAGCAAAACCTTTAATCGAGCTTCCAAAACCGAATATGCAGCTTACTGAAATAGCAACACTTGAAATTGCCGAAGGTTTAGTAAAGGTTAAAGAAGTTTGA |
Sequence | MRIEQINARALEKVNYDRYLLSQAIAKRVNELINGAKPLIELPKPNMQLTEIATLEIAEGLVKVKEV |
Source of smORF | Swiss-Prot |
Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
Pubmed ID | 19197347 |
Domain | CDD:417484 |
Functional Category | Others |
Uniprot ID | B9L8H3 |
ORF Length (Amino Acid) | 67 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 455162 | 455365 | - | NC_012115.1 | Nautilia profundicola AmH |
2 | 425621 | 425824 | - | NZ_CP027432.2 | Caminibacter pacificus |
3 | 1479744 | 1479947 | + | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
4 | 559685 | 559897 | - | NZ_AP023212.1 | Hydrogenimonas urashimensis |
5 | 660682 | 660891 | + | NZ_AP022847.1 | Nitrosophilus alvini |
6 | 785584 | 785799 | + | NZ_AP022826.1 | Nitrosophilus labii |
7 | 1804800 | 1805015 | + | NZ_CP031217.1 | Halarcobacter bivalviorum |
8 | 690063 | 690269 | + | NZ_CP011308.1 | Sulfurovum lithotrophicum |
9 | 644160 | 644366 | + | NZ_CP063164.1 | Sulfurovum indicum |
10 | 862639 | 862848 | + | NC_014935.1 | Nitratifractor salsuginis DSM 16511 |
11 | 1160513 | 1160731 | - | NZ_CP021886.1 | Helicobacter apodemus |
12 | 819043 | 819243 | - | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
13 | 791173 | 791373 | - | NZ_CP031218.1 | Malaciobacter halophilus |
14 | 856507 | 856707 | - | NZ_CP032101.1 | Malaciobacter marinus |
15 | 758920 | 759141 | - | NZ_CP032098.1 | Malaciobacter molluscorum LMG 25693 |
16 | 851985 | 852185 | - | NZ_CP042812.1 | Malaciobacter canalis |
17 | 653783 | 654001 | + | NZ_CP053848.1 | Campylobacter ornithocola |
18 | 1080234 | 1080452 | - | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
19 | 1382100 | 1382315 | - | NZ_CP012541.1 | Campylobacter concisus |
20 | 1403380 | 1403556 | - | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
21 | 537845 | 538063 | + | NZ_CP053842.1 | Campylobacter corcagiensis |
22 | 585970 | 586188 | + | NC_012039.1 | Campylobacter lari RM2100 |
23 | 684712 | 684930 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
24 | 128823 | 129002 | + | NZ_CP031611.1 | Campylobacter hepaticus |
25 | 643581 | 643799 | + | NZ_CP053825.1 | Campylobacter armoricus |
26 | 1300020 | 1300238 | + | NZ_CP063079.1 | Campylobacter peloridis |
27 | 472896 | 473075 | + | NZ_CP020478.1 | Campylobacter helveticus |
28 | 559775 | 559993 | + | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
29 | 1273948 | 1274163 | + | NZ_CP053831.1 | Campylobacter mucosalis |
30 | 1580938 | 1581150 | - | NZ_CP035946.1 | Campylobacter canadensis |
31 | 1206775 | 1206954 | - | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
32 | 579923 | 580141 | + | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
33 | 1301361 | 1301582 | - | NZ_CP010995.1 | Campylobacter iguaniorum |
34 | 1290150 | 1290329 | - | NZ_CP053841.1 | Campylobacter blaseri |
35 | 623453 | 623671 | + | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
36 | 330711 | 330929 | - | NC_014810.2 | Helicobacter felis ATCC 49179 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01520.20 | 1.0 | 36 | 4484.5 | same-strand | N-acetylmuramoyl-L-alanine amidase |
2 | PF03060.17 | 1.0 | 36 | 3391.5 | same-strand | Nitronate monooxygenase |
3 | PF00579.27 | 1.0 | 36 | 2187.0 | same-strand | tRNA synthetases class I (W and Y) |
4 | PF01479.27 | 0.67 | 24 | 2187 | same-strand | S4 domain |
5 | PF13328.8 | 1.0 | 36 | -13.0 | same-strand | HD domain |
6 | PF04607.19 | 1.0 | 36 | -13.0 | same-strand | Region found in RelA / SpoT proteins |
7 | PF02824.23 | 1.0 | 36 | -13.0 | same-strand | TGS domain |
8 | PF01966.24 | 0.89 | 32 | -3.0 | same-strand | HD domain |
9 | PF00696.30 | 1.0 | 36 | 17.5 | same-strand | Amino acid kinase family |
10 | PF02390.19 | 0.75 | 27 | 3474 | same-strand | Putative methyltransferase |
11 | PF00005.29 | 0.75 | 27 | 2808.0 | same-strand | ABC transporter |