Result : EXP03360
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03360 |
| NCBI Accession ID | |
| Organism | Prevotella |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGATCACCATGAAAAAAGAAAATTGGAAAGCAGTCATCAACTTCATTATCACCGTACTCACAGCGATAACCAGCGCTTTTTGCGTCAGCTCCTGCCAGAACCTTTAA |
| Sequence | MITMKKENWKAVINFIITVLTAITSAFCVSSCQNL |
| Source of smORF | Metagenomic Ribo-seq |
| Function | The ORF matches to the profile of NF033879. Profile Description: smalltalk protein. Smalltalk is a membrane-associated protein of very small size (less than 35 amino acids), found broadly in Bacteroides and Prevotella, both of which are prevalent in human gut microbiomes. Genomic context suggests a role in crosstalk in the gut microbiome, whether that involve toxins and immunity, signaling, or some other form of interaction. The family was identified and discussed by Sberro, et al., in a screen for overlooked small proteins encoded within human microbiomes, and named smalltalk here for its small size and cross-talk role. |
| Pubmed ID | 32601270 |
| Domain | CDD:411442 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 35 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1646607 | 1646705 | + | NZ_CP012938.1 | Bacteroides ovatus |
| 2 | 4068811 | 4068912 | - | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 3 | 2279251 | 2279364 | + | NZ_CP069440.1 | Phocaeicola coprophilus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP040530.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13148.8 | 0.67 | 2 | 803.5 | same-strand | Protein of unknown function (DUF3987) |
| 2 | PF08800.12 | 0.67 | 2 | 803.5 | same-strand | VirE N-terminal domain |
| 3 | PF08708.13 | 0.67 | 2 | 803.5 | same-strand | Primase C terminal 1 (PriCT-1) |
| 4 | PF18291.3 | 1.0 | 3 | 71 | same-strand | HU domain fused to wHTH, Ig, or Glycine-rich motif |
| 5 | PF00216.23 | 0.67 | 2 | 53.0 | same-strand | Bacterial DNA-binding protein |
| 6 | PF14848.8 | 0.67 | 2 | 131.5 | same-strand | DNA-binding domain |
| 7 | PF01510.27 | 0.67 | 2 | 13.5 | same-strand | N-acetylmuramoyl-L-alanine amidase |
| 8 | PF14053.8 | 1.0 | 3 | 526 | opposite-strand | Domain of unknown function (DUF4248) |
| 9 | PF02563.18 | 0.67 | 2 | 2377.0 | opposite-strand | Polysaccharide biosynthesis/export protein |
| 10 | PF10531.11 | 0.67 | 2 | 2377.0 | opposite-strand | SLBB domain |
++ More..