Result : B9L8F4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Translational regulator CsrA |
| NCBI Accession ID | CP001279.1 |
| Organism | Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) |
| Left | 434317 |
| Right | 434550 |
| Strand | - |
| Nucleotide Sequence | ATGTTAGTAATATCAAGGAAGATAAACGAAAAAATAAAAATCGGCGACGATATTGAAATAACCATTGTTTCAGTCGATAAAAACCAGGTAAAAATCGGAATAGACGCACCTAAAAACATACCTATATTAAGAAGCGAATTAATAGAGCAAATTACACAAGAGAACAAAAAAGCCGCAAAAGAAGTGGATATAACTGTTTTAAAAAATATATCCGACATATTCAAAGGGAATTAA |
| Sequence | MLVISRKINEKIKIGDDIEITIVSVDKNQVKIGIDAPKNIPILRSELIEQITQENKKAAKEVDITVLKNISDIFKGN |
| Source of smORF | Swiss-Prot |
| Function | A translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Usually binds in the 5'-UTR at or near the Shine-Dalgarno sequence preventing ribosome-binding, thus repressing translation. Its main target seems to be the major flagellin gene, while its function is anatagonized by FliW. {ECO:0000255|HAMAP-Rule:MF_00167}. |
| Pubmed ID | 19197347 |
| Domain | CDD:412510 |
| Functional Category | RNA-binding |
| Uniprot ID | B9L8F4 |
| ORF Length (Amino Acid) | 77 |
++ More..
| Conservation Analysis |
No. of Species: 73
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 434317 | 434550 | - | NC_012115.1 | Nautilia profundicola AmH |
| 2 | 404339 | 404572 | - | NZ_CP027432.2 | Caminibacter pacificus |
| 3 | 585907 | 586149 | + | NZ_CP012502.1 | Bacillus beveridgei |
| 4 | 3720287 | 3720514 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 5 | 1339574 | 1339804 | + | NZ_CP012544.1 | Campylobacter showae |
| 6 | 792673 | 792903 | - | NZ_CP012543.1 | Campylobacter rectus |
| 7 | 2871269 | 2871502 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 8 | 4988197 | 4988415 | - | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 9 | 3189801 | 3190037 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 10 | 1158804 | 1159037 | + | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 11 | 441635 | 441865 | + | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 12 | 2465311 | 2465562 | - | NZ_CP016379.1 | Anoxybacter fermentans |
| 13 | 1466178 | 1466390 | - | NZ_LT906477.1 | Clostridium cochlearium |
| 14 | 3006553 | 3006771 | - | NZ_CP030775.1 | Clostridium butyricum |
| 15 | 4890001 | 4890219 | - | NZ_CP043998.1 | Clostridium diolis |
| 16 | 1499832 | 1500065 | + | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
| 17 | 2558080 | 2558319 | + | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 18 | 3385613 | 3385843 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 19 | 1712686 | 1712910 | + | NZ_CP042997.1 | Aquisphaera giovannonii |
| 20 | 2835938 | 2836156 | - | NZ_CP028842.1 | Clostridium botulinum |
| 21 | 4047032 | 4047265 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 22 | 873459 | 873680 | + | NZ_CP020953.1 | Clostridium drakei |
| 23 | 158366 | 158596 | + | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 24 | 552217 | 552447 | + | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 25 | 1418612 | 1418827 | + | NZ_CP040924.1 | Clostridium thermarum |
| 26 | 1542445 | 1542672 | - | NZ_CP054142.1 | Treponema parvum |
| 27 | 661029 | 661256 | + | NZ_CP011361.2 | Salimicrobium jeotgali |
| 28 | 3067851 | 3068069 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 29 | 164863 | 165084 | + | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 30 | 2812340 | 2812570 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 31 | 1134230 | 1134457 | + | NZ_LR590481.1 | Hathewaya histolytica |
| 32 | 3446304 | 3446522 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 33 | 387891 | 388109 | + | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 34 | 476799 | 477020 | - | NC_011653.1 | Thermosipho africanus TCF52B |
| 35 | 4148289 | 4148531 | - | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 36 | 249184 | 249411 | - | NZ_CP007389.1 | Thermosipho melanesiensis |
| 37 | 4384755 | 4384973 | - | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 38 | 4471638 | 4471865 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 39 | 2335013 | 2335252 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 40 | 1353616 | 1353840 | - | NZ_CP016786.1 | Clostridium isatidis |
| 41 | 2081831 | 2082058 | + | NC_014393.1 | Clostridium cellulovorans 743B |
| 42 | 218110 | 218340 | - | NC_014758.1 | Calditerrivibrio nitroreducens DSM 19672 |
| 43 | 1031770 | 1031997 | - | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 44 | 705683 | 705913 | - | NZ_CP012541.1 | Campylobacter concisus |
| 45 | 185393 | 185629 | + | NZ_CP007022.1 | Borrelia parkeri HR1 |
| 46 | 185748 | 185984 | + | NZ_CP011060.1 | Borrelia hermsii CC1 |
| 47 | 3906917 | 3907126 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 48 | 2748682 | 2748894 | - | NZ_CP014150.1 | Paeniclostridium sordellii |
| 49 | 1575912 | 1576139 | - | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 50 | 2600386 | 2600619 | - | NC_013943.1 | Denitrovibrio acetiphilus DSM 12809 |
| 51 | 1981496 | 1981720 | - | NZ_CP032416.1 | Clostridium fermenticellae |
| 52 | 601505 | 601720 | - | NZ_CP023671.1 | Clostridium septicum |
| 53 | 3756421 | 3756633 | - | NZ_CP019870.1 | Clostridioides difficile |
| 54 | 1086108 | 1086326 | + | NC_008593.1 | Clostridium novyi NT |
| 55 | 2127170 | 2127385 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 56 | 949564 | 949791 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 57 | 3487544 | 3487771 | - | NZ_LS483476.1 | Lederbergia lentus |
| 58 | 205032 | 205247 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 59 | 619047 | 619265 | + | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 60 | 1055197 | 1055424 | - | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
| 61 | 178262 | 178486 | + | NZ_CP016540.2 | Planococcus versutus |
| 62 | 207133 | 207357 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 63 | 190154 | 190378 | + | NZ_CP019401.1 | Planococcus faecalis |
| 64 | 198739 | 198963 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 65 | 1572340 | 1572564 | - | NZ_CP013661.2 | Planococcus kocurii |
| 66 | 187245 | 187469 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 67 | 358345 | 358575 | - | NZ_CP034437.1 | Paenibacillus albus |
| 68 | 2003595 | 2003783 | - | NC_015276.1 | Marinomonas mediterranea MMB-1 |
| 69 | 3589291 | 3589527 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 70 | 186826 | 187065 | + | NC_015499.1 | Thermodesulfobium narugense DSM 14796 |
| 71 | 262435 | 262656 | + | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 72 | 1038110 | 1038337 | + | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 73 | 2658041 | 2658268 | + | NZ_CP022983.1 | Cytobacillus kochii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP012502.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00460.22 | 0.62 | 45 | 2018.0 | same-strand | Flagella basal body rod protein |
| 2 | PF00669.22 | 0.73 | 53 | 501 | same-strand | Bacterial flagellin N-terminal helical region |
| 3 | PF00700.23 | 0.64 | 47 | 519.0 | same-strand | Bacterial flagellin C-terminal helical region |
| 4 | PF02623.17 | 0.78 | 57 | 4 | same-strand | FliW protein |
++ More..