Result : A1KAG5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | AM406670.1 |
| Organism | Azoarcus sp. (strain BH72) |
| Left | 3529182 |
| Right | 3529478 |
| Strand | + |
| Nucleotide Sequence | ATGCCTGATCCGGACTCCACGCTGGCAGCACGCCTGCTGCGTATCCGTGGCCGCGTGCAGGGCGTCAGCTACCGCGCCAGCGCCCAGCGCGAGGCGCAGCGCCTGGGCCTGTCCGGCTGGGTGCGCAACCGGCACGACGGCAGCGTCGAAGCGCTGGTGTGCGGCCCCGCGGATACGGTGGAGCGCTTCATCGCCTGGGCGCACGTGGGCCCGCCGGCCGCCTCCGTCAGCGCGATCGAGGTCGGCGACGCAGCGCCGACCGACGGCGCCGGCTTCGACTGCCTGCCGACCTGCTGA |
| Sequence | MPDPDSTLAARLLRIRGRVQGVSYRASAQREAQRLGLSGWVRNRHDGSVEALVCGPADTVERFIAWAHVGPPAASVSAIEVGDAAPTDGAGFDCLPTC |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | 17057704 |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | A1KAG5 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 87
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3606007 | 3606303 | + | NZ_CP016210.1 | Azoarcus olearius |
| 2 | 2247995 | 2248294 | + | NZ_CP014646.1 | Thauera humireducens |
| 3 | 2218385 | 2218684 | + | NZ_CP029331.1 | Thauera hydrothermalis |
| 4 | 956805 | 957044 | - | NZ_CP025682.1 | Azoarcus pumilus |
| 5 | 2609971 | 2610213 | - | NC_006513.1 | Aromatoleum aromaticum EbN1 |
| 6 | 3066180 | 3066422 | - | NZ_CP059467.1 | Aromatoleum bremense |
| 7 | 3317828 | 3318121 | + | NZ_CP060790.1 | Acidovorax monticola |
| 8 | 1108452 | 1108709 | + | NZ_CP059560.1 | Aromatoleum petrolei |
| 9 | 3752438 | 3752710 | + | NZ_LR778301.1 | Denitratisoma oestradiolicum |
| 10 | 3321387 | 3321677 | - | NZ_CP047650.1 | Xylophilus rhododendri |
| 11 | 1223973 | 1224254 | + | NZ_CP060035.1 | Sphingobium fuliginis |
| 12 | 330048 | 330323 | - | NC_012804.1 | Thermococcus gammatolerans EJ3 |
| 13 | 1681993 | 1682274 | + | NC_014006.1 | Sphingobium japonicum UT26S |
| 14 | 3235798 | 3236040 | + | NZ_CP016278.1 | Diaphorobacter polyhydroxybutyrativorans |
| 15 | 979627 | 979902 | - | NZ_CP007140.1 | Thermococcus guaymasensis DSM 11113 |
| 16 | 174596 | 174871 | - | NZ_CP010835.1 | Pyrococcus kukulkanii |
| 17 | 142527 | 142802 | + | NZ_LT900021.1 | Thermococcus henrietii |
| 18 | 1428967 | 1429242 | - | NZ_CP006965.1 | Thermococcus paralvinellae |
| 19 | 456508 | 456783 | + | NZ_LN999010.1 | Thermococcus chitonophagus |
| 20 | 16694 | 16999 | - | NZ_CP051298.1 | Alicycliphilus denitrificans |
| 21 | 35519 | 35785 | + | NC_022084.1 | Thermococcus litoralis DSM 5473 |
| 22 | 712183 | 712425 | + | NZ_CP027666.1 | Ottowia oryzae |
| 23 | 293690 | 293965 | + | NZ_CP008887.1 | Thermococcus eurythermalis |
| 24 | 1216508 | 1216783 | + | NZ_CP014854.1 | Thermococcus celer Vu 13 = JCM 8558 |
| 25 | 1419648 | 1419902 | - | NZ_CP053069.1 | Usitatibacter rugosus |
| 26 | 1319368 | 1319643 | - | NC_014804.1 | Thermococcus barophilus MP |
| 27 | 7727843 | 7728154 | + | NC_017030.1 | Corallococcus coralloides DSM 2259 |
| 28 | 276885 | 277160 | + | NZ_CP023154.1 | Pyrococcus furiosus DSM 3638 |
| 29 | 1210855 | 1211130 | + | NC_015680.1 | Pyrococcus yayanosii CH1 |
| 30 | 1813627 | 1813893 | - | NZ_LR881183.1 | Thermococcus camini |
| 31 | 757679 | 757960 | - | NZ_AP017655.1 | Sphingobium cloacae |
| 32 | 1355157 | 1355429 | + | NZ_CP014855.1 | Thermococcus gorgonarius |
| 33 | 1643552 | 1643818 | - | NC_000868.1 | Pyrococcus abyssi GE5 |
| 34 | 1960952 | 1961227 | + | NZ_CP014862.1 | Thermococcus profundus |
| 35 | 943846 | 944121 | - | NZ_CP014750.1 | Thermococcus peptonophilus |
| 36 | 2190657 | 2190923 | - | NZ_CP040846.1 | Thermococcus indicus |
| 37 | 382094 | 382351 | + | NZ_CP020538.1 | Sphingobium herbicidovorans |
| 38 | 1363330 | 1363596 | - | NC_011529.1 | Thermococcus onnurineus NA1 |
| 39 | 3641231 | 3641470 | + | NC_010524.1 | Leptothrix cholodnii SP-6 |
| 40 | 291851 | 292126 | - | NZ_CP006019.1 | Palaeococcus pacificus DY20341 |
| 41 | 1191779 | 1192045 | + | NC_018015.1 | Thermococcus cleftensis |
| 42 | 270758 | 271033 | + | NC_000961.1 | Pyrococcus horikoshii OT3 |
| 43 | 638144 | 638404 | + | NZ_CP070326.1 | Streptomyces noursei |
| 44 | 1020633 | 1020908 | - | NZ_AP018721.1 | Sulfuritortus calidifontis |
| 45 | 1059461 | 1059736 | + | NC_012883.1 | Thermococcus sibiricus MM 739 |
| 46 | 1825590 | 1825865 | - | NC_006624.1 | Thermococcus kodakarensis KOD1 |
| 47 | 1430462 | 1430710 | + | NC_015514.1 | Cellulomonas fimi ATCC 484 |
| 48 | 1520142 | 1520417 | - | NZ_CP015101.1 | Thermococcus barossii |
| 49 | 707911 | 708186 | + | NZ_CP051131.1 | Parasphingopyxis algicola |
| 50 | 1537402 | 1537695 | - | NC_014217.1 | Starkeya novella DSM 506 |
| 51 | 442038 | 442328 | + | NC_014961.1 | Desulfurococcus mucosus DSM 2162 |
| 52 | 2876739 | 2876981 | - | NC_017956.1 | Tistrella mobilis KA081020-065 |
| 53 | 1390402 | 1390659 | - | NZ_CP016397.1 | Legionella clemsonensis |
| 54 | 1383091 | 1383366 | - | NZ_CP015106.1 | Thermococcus radiotolerans |
| 55 | 284396 | 284650 | + | NZ_CP035491.1 | Agromyces protaetiae |
| 56 | 957425 | 957667 | + | NC_022521.1 | Aeropyrum camini SY1 = JCM 12091 |
| 57 | 608929 | 609222 | + | NZ_CP022579.1 | Oryzomicrobium terrae |
| 58 | 3108554 | 3108805 | + | NZ_CP039546.1 | Methylorubrum populi |
| 59 | 710233 | 710487 | - | NZ_CP044231.1 | Microbacterium caowuchunii |
| 60 | 89247 | 89525 | + | NC_011144.1 | Phenylobacterium zucineum HLK1 |
| 61 | 2672662 | 2672922 | - | NZ_LT960614.1 | Hartmannibacter diazotrophicus |
| 62 | 1008960 | 1009202 | + | NC_000854.2 | Aeropyrum pernix K1 |
| 63 | 2132831 | 2133076 | + | NZ_CP029188.1 | Streptomyces tirandamycinicus |
| 64 | 2456069 | 2456329 | - | NC_015684.1 | Afipia carboxidovorans OM5 |
| 65 | 2798764 | 2799012 | - | NC_013959.1 | Sideroxydans lithotrophicus ES-1 |
| 66 | 4995623 | 4995898 | - | NZ_CP041730.1 | Chitinimonas arctica |
| 67 | 228918 | 229157 | + | NZ_CP023068.1 | Ensifer sojae CCBAU 05684 |
| 68 | 153133 | 153372 | - | NZ_CP034910.1 | Ensifer alkalisoli |
| 69 | 380841 | 381146 | - | NZ_CP027792.1 | Pulveribacter suum |
| 70 | 1502435 | 1502695 | - | NZ_CP015881.1 | Ensifer adhaerens |
| 71 | 1711990 | 1712265 | - | NZ_CP007264.1 | Thermococcus nautili |
| 72 | 3357673 | 3357930 | + | NZ_CP048711.1 | Kineobactrum salinum |
| 73 | 235812 | 236087 | - | NZ_CP015102.1 | Thermococcus pacificus |
| 74 | 2353012 | 2353272 | + | NZ_CP013480.3 | Pandoraea norimbergensis |
| 75 | 675856 | 676098 | + | NZ_CP029353.1 | Azospirillum thermophilum |
| 76 | 301821 | 302096 | - | NZ_CP015103.1 | Thermococcus siculi |
| 77 | 2552852 | 2553097 | - | NZ_AP014936.1 | Sulfurifustis variabilis |
| 78 | 4300586 | 4300861 | - | NZ_CP045201.1 | Pseudopuniceibacterium antarcticum |
| 79 | 3952014 | 3952289 | + | NZ_CP004393.1 | Celeribacter indicus |
| 80 | 111857 | 112165 | + | NZ_CP064781.1 | Azospira restricta |
| 81 | 1355105 | 1355347 | + | NZ_CP012401.1 | Azospirillum thiophilum |
| 82 | 3594625 | 3594864 | - | NZ_CP039287.1 | Cupriavidus necator H16 |
| 83 | 2899509 | 2899793 | + | NZ_CP043538.1 | Methylobacterium mesophilicum SR1.6/6 |
| 84 | 2815472 | 2815738 | + | NZ_CP044232.1 | Microbacterium lushaniae |
| 85 | 2899962 | 2900240 | - | NZ_CP036250.1 | Egicoccus halophilus |
| 86 | 3132177 | 3132461 | - | NZ_CP003811.1 | Methylobacterium oryzae CBMB20 |
| 87 | 1540160 | 1540420 | + | NZ_CP012946.1 | Blastochloris viridis |
++ More..