Result : EXP03350
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03350 |
| NCBI Accession ID | |
| Organism | Bacteroides |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGAAAAAAACGTGGAGTATTATTTTGAAAGTGATTATTGCTGTTGCCGGTGCGATTGCCGGAGTGGTAGGTGTGCAGGCAGCAACCTTGTCATTGATTATCTTATAA |
| Sequence | MKKTWSIILKVIIAVAGAIAGVVGVQAATLSLIIL |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 35 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4364981 | 4365076 | + | NZ_CP015401.2 | Bacteroides caecimuris |
| 2 | 1090427 | 1090519 | - | NZ_CP012938.1 | Bacteroides ovatus |
| 3 | 4150818 | 4150913 | + | NZ_CP012938.1 | Bacteroides ovatus |
| 4 | 429126 | 429227 | + | NZ_CP012938.1 | Bacteroides ovatus |
| 5 | 4339531 | 4339623 | + | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 6 | 4457925 | 4458026 | - | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 7 | 2155350 | 2155445 | + | NZ_LN877293.1 | Bacteroides fragilis |
| 8 | 4022257 | 4022352 | + | NZ_LN877293.1 | Bacteroides fragilis |
| 9 | 683718 | 683816 | - | NZ_CP054012.1 | Parabacteroides distasonis |
| 10 | 2355271 | 2355366 | + | NZ_CP054012.1 | Parabacteroides distasonis |
| 11 | 1056898 | 1056993 | - | NZ_CP054012.1 | Parabacteroides distasonis |
| 12 | 2470913 | 2471014 | - | NZ_CP027234.1 | Bacteroides heparinolyticus |
| 13 | 2607642 | 2607737 | + | NC_014933.1 | Bacteroides helcogenes P 36-108 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP015401.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF18291.3 | 0.86 | 6 | 267.5 | same-strand | HU domain fused to wHTH, Ig, or Glycine-rich motif |
| 2 | PF01510.27 | 0.71 | 5 | 99.5 | same-strand | N-acetylmuramoyl-L-alanine amidase |
++ More..