Result : B9KZB4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L35 |
| NCBI Accession ID | CP001275.1 |
| Organism | Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) |
| Left | 810442 |
| Right | 810642 |
| Strand | + |
| Nucleotide Sequence | ATGCCGAAGATGAAGACGAAGCGTGCCGCAGCCAAACGGTTCAAGATTACCGGGACAGGCAAGGTGATGCGAATGCGGCATGCTCGCAATCACAACCGACTGAAAAAGGCACCACGGGTTCGTCGTTCGTTCGACAAGATGGCGCCCGTTCACCCGTCCGATGTACACCGCGTGAAGCCGCTCCTACCGTACGCCTGGTGA |
| Sequence | MPKMKTKRAAAKRFKITGTGKVMRMRHARNHNRLKKAPRVRRSFDKMAPVHPSDVHRVKPLLPYAW |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00392. Profile Description: Ribosomal protein L35. This ribosomal protein is found in bacteria and organelles only. It is not closely related to any eukaryotic or archaeal ribosomal protein. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 19148287 |
| Domain | CDD:412354 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B9KZB4 |
| ORF Length (Amino Acid) | 66 |
++ More..
| Conservation Analysis |
No. of Species: 36
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 810442 | 810642 | + | NC_011959.1 | Thermomicrobium roseum DSM 5159 |
| 2 | 611123 | 611326 | - | NZ_CP006950.1 | Dehalococcoides mccartyi CG4 |
| 3 | 777443 | 777646 | + | NZ_CP018258.1 | Dehalogenimonas formicexedens |
| 4 | 805547 | 805747 | - | NC_014314.1 | Dehalogenimonas lykanthroporepellens BL-DC-9 |
| 5 | 525772 | 525969 | + | NZ_AP018558.1 | Hydrogenophilus thermoluteolus |
| 6 | 4324289 | 4324483 | - | NZ_CP040106.1 | Echinicola rosea |
| 7 | 825181 | 825378 | + | NZ_CP034118.1 | Staphylospora marina |
| 8 | 140219 | 140416 | + | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 9 | 4060179 | 4060373 | + | NC_019904.1 | Echinicola vietnamensis DSM 17526 |
| 10 | 2354826 | 2355023 | - | NZ_CP036259.1 | Sporomusa termitida |
| 11 | 1791633 | 1791830 | + | NZ_CP013019.1 | Clostridium pasteurianum |
| 12 | 1170934 | 1171131 | + | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 13 | 2513905 | 2514099 | - | NC_014158.1 | Tsukamurella paurometabola DSM 20162 |
| 14 | 3308058 | 3308255 | - | NZ_CP028842.1 | Clostridium botulinum |
| 15 | 3551061 | 3551258 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 16 | 964851 | 965045 | + | NC_018664.1 | Gottschalkia acidurici 9a |
| 17 | 457804 | 458001 | - | NZ_LT996885.1 | Dialister massiliensis |
| 18 | 884264 | 884452 | - | NZ_LR215037.1 | Mycoplasmopsis maculosa |
| 19 | 2321628 | 2321825 | - | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 20 | 2098968 | 2099162 | - | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 21 | 2235492 | 2235692 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 22 | 380583 | 380771 | + | NC_014921.1 | Mycoplasmopsis fermentans M64 |
| 23 | 700376 | 700564 | - | NZ_CP034841.1 | Mycoplasmopsis phocirhinis |
| 24 | 516861 | 517058 | + | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 25 | 1610228 | 1610425 | + | NZ_CP014176.1 | Clostridium argentinense |
| 26 | 2040191 | 2040388 | - | NC_016620.1 | Halobacteriovorax marinus SJ |
| 27 | 1294137 | 1294337 | - | NC_013523.1 | Sphaerobacter thermophilus DSM 20745 |
| 28 | 96141 | 96329 | + | NZ_AP022325.1 | Mycoplasmopsis felis |
| 29 | 1209717 | 1209917 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 30 | 872657 | 872842 | - | NZ_CP011232.1 | Kosmotoga pacifica |
| 31 | 1308760 | 1308957 | + | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 32 | 609575 | 609775 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 33 | 7644294 | 7644488 | + | NZ_CP023688.1 | Streptomyces rimosus |
| 34 | 2267928 | 2268122 | - | NZ_CP033325.1 | Georgenia faecalis |
| 35 | 2472260 | 2472457 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 36 | 2090569 | 2090766 | - | NZ_CP039710.1 | Thermoactinomyces vulgaris |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP018258.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00707.24 | 0.94 | 34 | 21.0 | same-strand | Translation initiation factor IF-3, C-terminal domain |
| 2 | PF00453.20 | 0.89 | 32 | 31.5 | same-strand | Ribosomal protein L20 |
| 3 | PF05198.18 | 0.67 | 24 | 20.5 | same-strand | Translation initiation factor IF-3, N-terminal domain |
++ More..