Result : EXP03317
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03317 |
| NCBI Accession ID | |
| Organism | |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGGAACAGCAATCGTTTTGGTAATAGTAATAGCGGTTATAGGATTTGCGGCATGGTCCGTGATAAAAGACAAAAAGAAAGGAAAGTCCTCCTGCGGCTGTGACTGCAAGCACTGCGCGATGAGCGCAAAGTGCCGCGGCGGAAAGTGA |
| Sequence | MGTAIVLVIVIAVIGFAAWSVIKDKKKGKSSCGCDCKHCAMSAKCRGGK |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 49 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3527902 | 3528042 | - | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 2 | 1024651 | 1024791 | + | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 3 | 1511302 | 1511439 | + | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP040058.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02421.20 | 1.0 | 3 | 60 | same-strand | Ferrous iron transport protein B |
| 2 | PF07670.16 | 1.0 | 3 | 60 | same-strand | Nucleoside recognition |
| 3 | PF07664.14 | 1.0 | 3 | 60 | same-strand | Ferrous iron transport protein B C terminus |
| 4 | PF01926.25 | 1.0 | 3 | 60 | same-strand | 50S ribosome-binding GTPase |
| 5 | PF17910.3 | 1.0 | 3 | 60 | same-strand | FeoB cytosolic helical domain |
| 6 | PF04023.16 | 1.0 | 3 | 2465.0 | same-strand | FeoA domain |
| 7 | PF02742.17 | 0.67 | 2 | 3098.5 | opposite-strand | Iron dependent repressor, metal binding and dimerisation domain |
| 8 | PF01325.21 | 0.67 | 2 | 3098.5 | opposite-strand | Iron dependent repressor, N-terminal DNA binding domain |
++ More..