Protein Information |
Information Type | Description |
---|---|
Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
NCBI Accession ID | CP000932.1 |
Organism | Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) |
Left | 462042 |
Right | 462329 |
Strand | + |
Nucleotide Sequence | ATGCAAATTGATGATAAATTATTGACTAAACTTGAAAAGCTAAGTGCTTTAAAAATTGCCGATGATAAAAGACAAGAATTGGAAGAACAATTGAGTCAGATTGTTAATTTTGTAGAAAAATTAGATGAGCTAAAACTTGATGATGTTGAAGCTATGACTAGCACTACAAATACTGCAACGCCATTTAGACTAGATGAAAGTAGAAAATCTGATGTGATAGATATGGTTAGTAAGCATGCTCCAAATTCTCAAGATGGATTTTTTATAGTTCCTAAAATAATTGAATAA |
Sequence | MQIDDKLLTKLEKLSALKIADDKRQELEEQLSQIVNFVEKLDELKLDDVEAMTSTTNTATPFRLDESRKSDVIDMVSKHAPNSQDGFFIVPKIIE |
Source of smORF | Swiss-Prot |
Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
Pubmed ID | 18713059 |
Domain | CDD:412411 |
Functional Category | Others |
Uniprot ID | B9KFJ8 |
ORF Length (Amino Acid) | 95 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 462042 | 462329 | + | NC_012039.1 | Campylobacter lari RM2100 |
2 | 478354 | 478641 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
3 | 466327 | 466614 | + | NZ_CP053825.1 | Campylobacter armoricus |
4 | 476981 | 477268 | + | NZ_CP053848.1 | Campylobacter ornithocola |
5 | 1234380 | 1234667 | + | NZ_CP063079.1 | Campylobacter peloridis |
6 | 524945 | 525232 | + | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
7 | 543297 | 543584 | + | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
8 | 418505 | 418792 | + | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
9 | 159553 | 159840 | - | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
10 | 1913817 | 1914104 | - | NZ_CP012196.1 | Campylobacter gracilis |
11 | 1143442 | 1143729 | - | NZ_CP059443.1 | Campylobacter fetus |
12 | 1257708 | 1257995 | - | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
13 | 1555212 | 1555499 | - | NZ_CP012541.1 | Campylobacter concisus |
14 | 1248380 | 1248667 | - | NZ_CP010995.1 | Campylobacter iguaniorum |
15 | 693304 | 693591 | + | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
16 | 489150 | 489437 | + | NZ_CP053831.1 | Campylobacter mucosalis |
17 | 565599 | 565889 | - | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
18 | 1249544 | 1249834 | + | NZ_CP041406.1 | Sulfurimonas paralvinellae |
19 | 364326 | 364610 | + | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
20 | 547037 | 547324 | + | NZ_CP012544.1 | Campylobacter showae |
21 | 464059 | 464346 | + | NZ_CP012543.1 | Campylobacter rectus |
22 | 519473 | 519760 | + | NZ_CP053826.1 | Campylobacter curvus |
23 | 724506 | 724793 | - | NZ_CP020478.1 | Campylobacter helveticus |
24 | 724129 | 724419 | - | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
25 | 752222 | 752512 | - | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
26 | 662492 | 662782 | - | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
27 | 1032144 | 1032431 | + | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
28 | 1636590 | 1636877 | - | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
29 | 1349670 | 1349960 | + | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
30 | 2034928 | 2035206 | - | NZ_AP018676.1 | Helicobacter cinaedi |
31 | 240724 | 241011 | - | NZ_CP053842.1 | Campylobacter corcagiensis |
32 | 2095023 | 2095313 | + | NZ_AP014724.1 | Sulfurospirillum cavolei |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02674.18 | 0.91 | 29 | 1066 | same-strand | Colicin V production protein |
2 | PF01475.21 | 0.91 | 29 | 1641 | same-strand | Ferric uptake regulator family |
3 | PF00152.22 | 0.91 | 29 | 2119 | same-strand | tRNA synthetases class II (D, K and N) |
4 | PF01336.27 | 0.91 | 29 | 2119 | same-strand | OB-fold nucleic acid binding domain |
5 | PF00464.21 | 0.78 | 25 | 3607 | same-strand | Serine hydroxymethyltransferase |