Result : EXP03263
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03263 |
| NCBI Accession ID | |
| Organism | Bifidobacterium |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGAACCTGTATCGCTACGCGATGTTCATCGCACACGCCTGCCGTGGGTCGTTCGTCGGCAATGTTCTGTTTGCCAATCCACAAATGTCCCTTTTTTCGATGCTGGTGTAG |
| Sequence | MNLYRYAMFIAHACRGSFVGNVLFANPQMSLFSMLV |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 36 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 754154 | 754264 | + | NZ_AP012325.1 | Bifidobacterium catenulatum DSM 16992 = JCM 1194 = LMG 11043 |
| 2 | 836004 | 836114 | + | NZ_CP025199.1 | Bifidobacterium pseudocatenulatum |
| 3 | 932371 | 932481 | + | NZ_CP026999.1 | Bifidobacterium longum |
| 4 | 1966485 | 1966595 | - | NZ_CP028341.1 | Bifidobacterium adolescentis |
| 5 | 998141 | 998251 | + | NZ_CP006712.1 | Bifidobacterium breve JCM 7017 |
| 6 | 1177184 | 1177294 | - | NZ_AP012322.1 | Bifidobacterium angulatum DSM 20098 = JCM 7096 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP012325.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07730.15 | 0.67 | 4 | 4279.0 | opposite-strand | Histidine kinase |
| 2 | PF14748.8 | 0.67 | 4 | 1898.0 | same-strand | Pyrroline-5-carboxylate reductase dimerisation |
| 3 | PF03807.19 | 0.67 | 4 | 1898.0 | same-strand | NADP oxidoreductase coenzyme F420-dependent |
| 4 | PF06071.15 | 0.67 | 4 | 783.5 | same-strand | Protein of unknown function (DUF933) |
| 5 | PF03733.15 | 0.83 | 5 | 264 | opposite-strand | Inner membrane component domain |
| 6 | PF07690.18 | 1.0 | 6 | 231.0 | same-strand | Major Facilitator Superfamily |
| 7 | PF00571.30 | 1.0 | 6 | 231.0 | same-strand | CBS domain |
++ More..