Result : B9DPL6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | AM295250.1 |
| Organism | Staphylococcus carnosus (strain TM300) |
| Left | 825628 |
| Right | 825858 |
| Strand | + |
| Nucleotide Sequence | ATGTTATACCCACCGCTAAACCAACTCACTTCAAAAGTAAGTTCAAAATATTTAATCGCTACAGTGGCAGCCAAACGCGCACGTGAATTATATGATAAACCTGAAACAGCACTTTTAGAACACTATCACTCAGTAAAAACTGTTGGTAAAGCTTTAGAAGAAATTGCTGCTGGTAAAATCACTCCGATTGAACCAGAATTGAATGAAAGCGAATTTGAAACAAAAGACTGA |
| Sequence | MLYPPLNQLTSKVSSKYLIATVAAKRARELYDKPETALLEHYHSVKTVGKALEEIAAGKITPIEPELNESEFETKD |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
| Pubmed ID | 19060169 |
| Domain | CDD:417484 |
| Functional Category | Others |
| Uniprot ID | B9DPL6 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 76
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1811857 | 1812087 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 2 | 1271609 | 1271839 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 3 | 123257 | 123469 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 4 | 1762729 | 1762941 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 5 | 1696119 | 1696331 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 6 | 859643 | 859855 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 7 | 506680 | 506892 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 8 | 1680661 | 1680873 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 9 | 1635235 | 1635447 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 10 | 2345500 | 2345712 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 11 | 592871 | 593083 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 12 | 957896 | 958105 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 13 | 157865 | 158077 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 14 | 1127474 | 1127692 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 15 | 1153229 | 1153441 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 16 | 1664902 | 1665105 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 17 | 1742698 | 1742910 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 18 | 1647097 | 1647309 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 19 | 1197376 | 1197594 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 20 | 1496096 | 1496302 | - | NZ_CP065712.1 | Staphylococcus auricularis |
| 21 | 1002488 | 1002703 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 22 | 2177479 | 2177688 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 23 | 1670516 | 1670737 | + | NZ_CP027770.1 | Staphylococcus felis |
| 24 | 957023 | 957232 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 25 | 1723736 | 1723945 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 26 | 836836 | 837045 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 27 | 815840 | 816049 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 28 | 996677 | 996874 | + | NZ_CP046314.1 | Gemella morbillorum |
| 29 | 1123918 | 1124112 | + | NZ_CP011366.1 | Salinicoccus halodurans |
| 30 | 1516196 | 1516423 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 31 | 1003864 | 1004058 | - | NZ_CP019573.1 | Abyssicoccus albus |
| 32 | 1322000 | 1322227 | + | NZ_CP012024.1 | Bacillus smithii |
| 33 | 1953821 | 1954024 | + | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 34 | 646783 | 646986 | + | NZ_CP045563.1 | Fructilactobacillus sanfranciscensis |
| 35 | 2454619 | 2454816 | + | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 36 | 2229569 | 2229793 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 37 | 2989203 | 2989427 | + | NZ_CP013661.2 | Planococcus kocurii |
| 38 | 2274264 | 2274488 | - | NZ_CP019401.1 | Planococcus faecalis |
| 39 | 1263921 | 1264163 | + | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 40 | 717217 | 717435 | + | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 41 | 736122 | 736310 | + | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 42 | 729919 | 730107 | + | NZ_AP018549.1 | Lactobacillus paragasseri |
| 43 | 410165 | 410362 | - | NZ_CP049889.1 | Jeotgalibaca porci |
| 44 | 2415106 | 2415330 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 45 | 869591 | 869791 | + | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 46 | 2126263 | 2126487 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 47 | 1818852 | 1819076 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 48 | 599213 | 599416 | + | NZ_CP045562.1 | Fructilactobacillus fructivorans |
| 49 | 586483 | 586683 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 50 | 141085 | 141297 | - | NZ_CP018888.1 | Amylolactobacillus amylophilus DSM 20533 = JCM 1125 |
| 51 | 1875917 | 1876120 | - | NZ_LT906444.1 | Listeria welshimeri |
| 52 | 1902281 | 1902484 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 53 | 1401133 | 1401336 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 54 | 1860455 | 1860658 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 55 | 1956270 | 1956473 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 56 | 1014165 | 1014380 | + | NZ_AP014680.1 | Paucilactobacillus hokkaidonensis JCM 18461 |
| 57 | 1010059 | 1010268 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 58 | 2137295 | 2137510 | - | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 59 | 2006904 | 2007098 | - | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 60 | 1149527 | 1149712 | - | NZ_CP029544.1 | Lactobacillus helsingborgensis |
| 61 | 2185099 | 2185299 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 62 | 991263 | 991469 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 63 | 1233344 | 1233529 | - | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 64 | 4189187 | 4189393 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 65 | 2761544 | 2761750 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 66 | 1773722 | 1773922 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 67 | 2117209 | 2117427 | + | NZ_CP053989.1 | Niallia circulans |
| 68 | 841329 | 841535 | + | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 69 | 2819743 | 2819940 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 70 | 1165395 | 1165607 | - | NZ_LR134375.1 | Veillonella dispar |
| 71 | 331754 | 331951 | + | NZ_LT996885.1 | Dialister massiliensis |
| 72 | 1770415 | 1770615 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 73 | 1210192 | 1210404 | - | NZ_LR778174.1 | Veillonella parvula |
| 74 | 940570 | 940782 | + | NZ_LT906470.1 | Veillonella rodentium |
| 75 | 2150370 | 2150576 | - | NZ_CP036259.1 | Sporomusa termitida |
| 76 | 1107260 | 1107472 | - | NZ_AP022321.1 | Veillonella nakazawae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP033732.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF17764.3 | 0.95 | 72 | 1392.0 | same-strand | 3'DNA-binding domain (3'BD) |
| 2 | PF18074.3 | 0.95 | 72 | 1392.0 | same-strand | Primosomal protein N C-terminal domain |
| 3 | PF04851.17 | 0.95 | 72 | 1392.0 | same-strand | Type III restriction enzyme, res subunit |
| 4 | PF00270.31 | 0.95 | 72 | 1392.0 | same-strand | DEAD/DEAH box helicase |
| 5 | PF18319.3 | 0.95 | 72 | 1392.0 | same-strand | PriA DNA helicase Cys-rich region (CRR) domain |
| 6 | PF04127.17 | 0.83 | 63 | 157 | same-strand | DNA / pantothenate metabolism flavoprotein |
| 7 | PF02441.21 | 0.83 | 63 | 157 | same-strand | Flavoprotein |
| 8 | PF00625.23 | 1.0 | 76 | 0.0 | same-strand | Guanylate kinase |
| 9 | PF05833.13 | 0.76 | 58 | 923.5 | opposite-strand | NFACT N-terminal and middle domains |
| 10 | PF05670.15 | 0.76 | 58 | 923.5 | opposite-strand | NFACT protein RNA binding domain |
| 11 | PF00551.21 | 0.75 | 57 | 4192 | same-strand | Formyl transferase |
| 12 | PF02911.20 | 0.75 | 57 | 4192 | same-strand | Formyl transferase, C-terminal domain |
++ More..