Result : EXP03244
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03244 |
| NCBI Accession ID | |
| Organism | Bacteroides,Carnobacterium |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGTGCGTCATGAAAAAGAGAAGTTTCCTGGATACCGAGAGTCTGTCGGCTCTAGAAGCTGTGGCTATCATTGTATTGTTCTTTGCTTTGATAACATGGATTCTTGATCTTTGA |
| Sequence | MCVMKKRSFLDTESLSALEAVAIIVLFFALITWILDL |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 37 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4503920 | 4504033 | - | NZ_LR699004.1 | Phocaeicola dorei |
| 2 | 4095806 | 4095919 | - | NC_009614.1 | Phocaeicola vulgatus ATCC 8482 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR699004.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00982.23 | 1.0 | 2 | 4516.0 | same-strand | Glycosyltransferase family 20 |
| 2 | PF02358.18 | 1.0 | 2 | 4516.0 | same-strand | Trehalose-phosphatase |
| 3 | PF00302.20 | 1.0 | 2 | 1764.0 | opposite-strand | Chloramphenicol acetyltransferase |
| 4 | PF13419.8 | 1.0 | 2 | 1037.5 | opposite-strand | Haloacid dehalogenase-like hydrolase |
| 5 | PF00702.28 | 1.0 | 2 | 794.5 | both-strands | haloacid dehalogenase-like hydrolase |
| 6 | PF02669.17 | 1.0 | 2 | 30.5 | same-strand | K+-transporting ATPase, c chain |
| 7 | PF00122.22 | 1.0 | 2 | 613.5 | same-strand | E1-E2 ATPase |
| 8 | PF03814.17 | 1.0 | 2 | 2680.5 | same-strand | Potassium-transporting ATPase A subunit |
| 9 | PF01661.23 | 1.0 | 2 | 4762.0 | opposite-strand | Macro domain |
++ More..