Result : B8J890
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S16 |
| NCBI Accession ID | CP001359.1 |
| Organism | Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) |
| Left | 2288754 |
| Right | 2289020 |
| Strand | + |
| Nucleotide Sequence | ATGGCGGTCGTTCTTCGTCTGTCGCGCGCGGGCACGCACAAGGCGCCCTTCTATCACGTGGTGGCGACCGACTCGCGCAACGCGCGGGACGGCAAGTACCTCGAGGACGTCGGCATCTACGATCCGACCAAGCGCCCGGAGCGGATCGAGCTCAAGGTCGAGCGGATCGAGCACTGGCTGAAGGCCGGCGCCAAGCCGAGCCAGACGGTCGCGATGATCCTCAAGCGGGCCGCGAAGGCGGCCGCTCCCGCCGCGCCGAAGGCGTAA |
| Sequence | MAVVLRLSRAGTHKAPFYHVVATDSRNARDGKYLEDVGIYDPTKRPERIELKVERIEHWLKAGAKPSQTVAMILKRAAKAAAPAAPKA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00368. Profile Description: Ribosomal protein S16. This model describes ribosomal S16 of bacteria and organelles. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | |
| Domain | CDD:412339 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B8J890 |
| ORF Length (Amino Acid) | 88 |
++ More..
| Conservation Analysis |
No. of Species: 74
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2288754 | 2289020 | + | NC_011891.1 | Anaeromyxobacter dehalogenans 2CP-1 |
| 2 | 8369501 | 8369761 | + | NZ_CP022163.1 | Melittangium boletus DSM 14713 |
| 3 | 4130752 | 4131012 | + | NC_008095.1 | Myxococcus xanthus DK 1622 |
| 4 | 4169161 | 4169421 | + | NZ_CP022203.1 | Corallococcus macrosporus DSM 14697 |
| 5 | 4291725 | 4291985 | - | NZ_CP012109.1 | Myxococcus hansupus |
| 6 | 5729444 | 5729707 | - | NC_020126.1 | Myxococcus stipitatus DSM 14675 |
| 7 | 5695193 | 5695453 | - | NC_017030.1 | Corallococcus coralloides DSM 2259 |
| 8 | 3908128 | 3908391 | - | NZ_CP012373.2 | Beggiatoa leptomitoformis |
| 9 | 5313795 | 5314055 | + | NZ_CP012159.1 | Chondromyces crocatus |
| 10 | 2372021 | 2372278 | - | NZ_CP016268.1 | Woeseia oceani |
| 11 | 4626608 | 4626856 | - | NZ_CP020038.1 | Agarilytica rhodophyticola |
| 12 | 2525440 | 2525688 | - | NZ_LS483250.1 | Moritella yayanosii |
| 13 | 2018827 | 2019075 | - | NZ_AP018725.1 | Sulfuriflexus mobilis |
| 14 | 766445 | 766693 | - | NC_018868.3 | Simiduia agarivorans SA1 = DSM 21679 |
| 15 | 972367 | 972615 | + | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 16 | 438017 | 438265 | + | NC_010554.1 | Proteus mirabilis HI4320 |
| 17 | 2805337 | 2805570 | + | NZ_CP047495.1 | Pectobacterium brasiliense |
| 18 | 1151035 | 1151268 | + | NZ_CP051652.1 | Pectobacterium carotovorum |
| 19 | 3433461 | 3433709 | - | NZ_CP044399.1 | Moritella marina ATCC 15381 |
| 20 | 1230160 | 1230402 | - | NZ_CP022684.1 | Ketobacter alkanivorans |
| 21 | 2514201 | 2514434 | - | NZ_CP017482.1 | Pectobacterium polaris |
| 22 | 5757353 | 5757616 | - | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 23 | 1134174 | 1134422 | + | NZ_CP029185.2 | Limnobaculum parvum |
| 24 | 4004263 | 4004514 | - | NC_012560.1 | Azotobacter vinelandii DJ |
| 25 | 1162676 | 1162933 | - | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 26 | 3697374 | 3697607 | - | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 27 | 3764708 | 3764956 | - | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 28 | 1424784 | 1425041 | + | NZ_CP046603.1 | Lysobacter soli |
| 29 | 2268505 | 2268747 | - | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 30 | 3290567 | 3290812 | - | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 31 | 2812872 | 2813120 | - | NZ_LR134531.1 | Pragia fontium |
| 32 | 2617772 | 2618035 | + | NC_010814.1 | Geobacter lovleyi SZ |
| 33 | 1502814 | 1503089 | - | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 34 | 1999977 | 2000222 | - | NZ_CP012332.1 | Vulgatibacter incomptus |
| 35 | 606358 | 606606 | + | NZ_CP060401.1 | Xenorhabdus nematophila |
| 36 | 1299302 | 1299535 | + | NZ_CP065044.1 | Pectobacterium aroidearum |
| 37 | 583859 | 584095 | + | NZ_CP043929.1 | Methylomonas rhizoryzae |
| 38 | 1099818 | 1100066 | + | NZ_LS483470.1 | Leminorella richardii |
| 39 | 2591492 | 2591764 | + | NZ_CP037940.1 | Weissella cryptocerci |
| 40 | 1078788 | 1079060 | + | NZ_AP019309.1 | Intestinibaculum porci |
| 41 | 2128840 | 2129085 | - | NZ_LR699011.1 | Roseburia hominis |
| 42 | 1576561 | 1576836 | + | NZ_CP023011.2 | Enterococcus hirae |
| 43 | 1451801 | 1452088 | - | NZ_CP014164.1 | Aerococcus viridans |
| 44 | 668301 | 668579 | + | NZ_CP045563.1 | Fructilactobacillus sanfranciscensis |
| 45 | 613475 | 613741 | + | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 46 | 667836 | 668111 | + | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 47 | 3367486 | 3367776 | - | NZ_CP011801.1 | Nitrospira moscoviensis |
| 48 | 56258 | 56542 | - | NZ_LT828648.1 | Nitrospira japonica |
| 49 | 2619331 | 2619570 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 50 | 1262692 | 1262964 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 51 | 1181299 | 1181571 | - | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 52 | 724623 | 724910 | + | NZ_CP013988.1 | Aerococcus urinaeequi |
| 53 | 2158819 | 2159091 | - | NZ_CP060715.1 | Erysipelothrix inopinata |
| 54 | 4880918 | 4881169 | - | NZ_AP022642.1 | Pseudomonas otitidis |
| 55 | 1475280 | 1475537 | - | NZ_CP071517.1 | Lysobacter arenosi |
| 56 | 6263072 | 6263338 | - | NC_010162.1 | Sorangium cellulosum So ce56 |
| 57 | 1547192 | 1547473 | - | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 58 | 1445542 | 1445817 | + | NZ_CP060720.1 | Vagococcus carniphilus |
| 59 | 1794264 | 1794503 | + | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 60 | 2673388 | 2673633 | - | NC_014624.2 | Eubacterium callanderi |
| 61 | 3103001 | 3103246 | + | NZ_CP019962.1 | Eubacterium limosum |
| 62 | 842152 | 842391 | + | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 63 | 4386109 | 4386345 | - | NC_015572.1 | Methylomonas methanica MC09 |
| 64 | 1362803 | 1363084 | - | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 65 | 2793123 | 2793398 | - | NZ_CP049887.1 | Vagococcus hydrophili |
| 66 | 1693559 | 1693834 | - | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 67 | 4299739 | 4299984 | + | NZ_CP029487.1 | Eubacterium maltosivorans |
| 68 | 81771 | 82007 | - | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 69 | 265211 | 265483 | + | NZ_CP014835.1 | Streptococcus halotolerans |
| 70 | 1165377 | 1165634 | + | NZ_CP011971.1 | Steroidobacter denitrificans |
| 71 | 854672 | 854947 | + | NZ_CP047141.1 | Ligilactobacillus animalis |
| 72 | 705577 | 705813 | + | NC_015682.1 | Thermodesulfobacterium geofontis OPF15 |
| 73 | 884508 | 884753 | - | NZ_AP019711.1 | Amedibacterium intestinale |
| 74 | 192551 | 192817 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP020038.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01782.20 | 0.95 | 70 | 269.5 | same-strand | RimM N-terminal domain |
| 2 | PF05239.18 | 0.93 | 69 | 267 | same-strand | PRC-barrel domain |
| 3 | PF01746.23 | 0.97 | 72 | 787.0 | same-strand | tRNA (Guanine-1)-methyltransferase |
| 4 | PF01245.22 | 0.81 | 60 | 1506.5 | same-strand | Ribosomal protein L19 |
| 5 | PF00448.24 | 0.74 | 55 | 151 | same-strand | SRP54-type protein, GTPase domain |
| 6 | PF02978.21 | 0.74 | 55 | 138 | same-strand | Signal peptide binding domain |
| 7 | PF02881.21 | 0.74 | 55 | 151 | same-strand | SRP54-type protein, helical bundle domain |
++ More..