Result : EXP03237
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03237 |
| NCBI Accession ID | |
| Organism | Escherichia,Klebsiella,Enterobacter |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGCGTCGACTGTTGCACTATCTCATCAATAATATTCGCGAGCATCTGATGCTTTATCTTTTTCTCTGGGGATTGTTGGCAATTATGGATCTGATCTATGTGTTTTATTTTTAG |
| Sequence | MRRLLHYLINNIREHLMLYLFLWGLLAIMDLIYVFYF |
| Source of smORF | Metagenomic Ribo-seq |
| Function | The ORF matches to the profile of pfam10968. Profile Description: Protein of unknown function (DUF2770). Members in this family of proteins are annotated as yceO however currently no function is known. |
| Pubmed ID | 32601270 |
| Domain | CDD:371319 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 37 |
++ More..
| Conservation Analysis |
No. of Species: 49
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1478589 | 1478702 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 1119307 | 1119420 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 1107065 | 1107178 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 1696534 | 1696647 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 1128104 | 1128217 | - | NZ_AP014857.1 | Escherichia albertii |
| 6 | 1762939 | 1763052 | - | NZ_LR134340.1 | Escherichia marmotae |
| 7 | 4597632 | 4597745 | - | NZ_CP033744.1 | Citrobacter freundii |
| 8 | 520377 | 520490 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 9 | 3029777 | 3029890 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 10 | 1578676 | 1578789 | + | NZ_CP038469.1 | Citrobacter tructae |
| 11 | 1216518 | 1216631 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 12 | 1246256 | 1246369 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 13 | 1733038 | 1733151 | - | NC_015968.1 | Enterobacter soli |
| 14 | 1748067 | 1748180 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 15 | 3659851 | 3659964 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 16 | 3410725 | 3410838 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 17 | 928981 | 929094 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 18 | 4238806 | 4238919 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 19 | 1746679 | 1746792 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 20 | 1155290 | 1155403 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 21 | 1883066 | 1883182 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 22 | 1983452 | 1983565 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 23 | 1867251 | 1867364 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 24 | 3211966 | 3212079 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 25 | 2509128 | 2509244 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 26 | 1242434 | 1242550 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 27 | 1760433 | 1760546 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 28 | 1885039 | 1885152 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 29 | 3312791 | 3312904 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 30 | 627903 | 628016 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 31 | 1185722 | 1185838 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 32 | 3281199 | 3281312 | + | NZ_CP041247.1 | Raoultella electrica |
| 33 | 3775082 | 3775195 | - | NZ_CP026047.1 | Raoultella planticola |
| 34 | 3484378 | 3484491 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 35 | 3105422 | 3105535 | + | NZ_CP023525.1 | Cedecea neteri |
| 36 | 3597598 | 3597711 | + | NZ_CP050508.1 | Raoultella terrigena |
| 37 | 3635473 | 3635586 | - | NZ_CP053416.1 | Salmonella bongori |
| 38 | 3773013 | 3773126 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 39 | 1379782 | 1379883 | - | NZ_CP032487.1 | Yersinia hibernica |
| 40 | 1891599 | 1891700 | - | NZ_CP011118.1 | Yersinia enterocolitica |
| 41 | 1916116 | 1916208 | - | NZ_CP043727.1 | Yersinia canariae |
| 42 | 1779639 | 1779752 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 43 | 3606993 | 3607106 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 44 | 3488414 | 3488527 | + | NZ_CP054254.1 | Klebsiella variicola |
| 45 | 2013822 | 2013935 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 46 | 3240143 | 3240256 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 47 | 793287 | 793400 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 48 | 1713631 | 1713744 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 49 | 2797828 | 2797941 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 50 | 3156263 | 3156364 | - | NZ_CP023706.1 | Edwardsiella tarda |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03279.15 | 0.9 | 44 | 2705 | same-strand | Bacterial lipid A biosynthesis acyltransferase |
| 2 | PF17773.3 | 0.96 | 47 | 1426.5 | opposite-strand | UPF0176 acylphosphatase like domain |
| 3 | PF12368.10 | 0.96 | 47 | 1426.5 | opposite-strand | Rhodanase C-terminal |
| 4 | PF00581.22 | 0.96 | 47 | 1426.5 | opposite-strand | Rhodanese-like domain |
| 5 | PF04264.15 | 0.63 | 31 | 829.0 | same-strand | YceI-like domain |
| 6 | PF01292.22 | 0.63 | 31 | 261.0 | same-strand | Prokaryotic cytochrome b561 |
| 7 | PF01266.26 | 1.0 | 49 | 57.0 | same-strand | FAD dependent oxidoreductase |
| 8 | PF13991.8 | 0.98 | 48 | 1295 | same-strand | BssS protein family |
| 9 | PF06183.15 | 0.98 | 48 | 1825 | same-strand | DinI-like family |
| 10 | PF01979.22 | 0.94 | 46 | 2144 | same-strand | Amidohydrolase family |
| 11 | PF07273.14 | 0.8 | 39 | 3318.5 | same-strand | Protein of unknown function (DUF1439) |
| 12 | PF12832.9 | 0.84 | 41 | 3755 | same-strand | MFS 1 like family |
++ More..