Result : B8J1U2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S16 |
| NCBI Accession ID | CP001358.1 |
| Organism | Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB) |
| Left | 2176871 |
| Right | 2177110 |
| Strand | - |
| Nucleotide Sequence | ATGGCTGTAAAGTTGAAATTGACCCGCCTCGGCAGCAAAAAGCACCCCTTCTACCGGGTGGTGGCCGCCACTGACGAAACCCGTCGTGATGGCCGTCCGCTGGAGTTTCTGGGCTACTATAATCCCATGACTGATCCGGTTGAAGTCAAGCTCGATGCGGACAAAATCAAGGAATGGCTGGCCCGTGGCGCAGAACCCACGGACACCGTCCGCGCCCTGATTAAAAAACACATGGCCTAG |
| Sequence | MAVKLKLTRLGSKKHPFYRVVAATDETRRDGRPLEFLGYYNPMTDPVEVKLDADKIKEWLARGAEPTDTVRALIKKHMA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00368. Profile Description: Ribosomal protein S16. This model describes ribosomal S16 of bacteria and organelles. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | |
| Domain | CDD:412339 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B8J1U2 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 416
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2319655 | 2319894 | - | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 2 | 1057781 | 1058020 | + | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 3 | 931685 | 931924 | - | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 4 | 3904966 | 3905205 | - | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 5 | 211932 | 212168 | + | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 6 | 1127275 | 1127514 | - | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 7 | 2619331 | 2619570 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 8 | 3741561 | 3741806 | + | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 9 | 2287928 | 2288173 | - | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 10 | 1794264 | 1794503 | + | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 11 | 4043633 | 4043872 | - | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 12 | 2208415 | 2208660 | - | NZ_CP039543.1 | Desulfovibrio marinus |
| 13 | 565975 | 566214 | - | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 14 | 705479 | 705727 | - | NC_020127.1 | Lawsonia intracellularis N343 |
| 15 | 842152 | 842391 | + | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 16 | 3000715 | 3000954 | + | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 17 | 2322839 | 2323084 | - | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 18 | 1425512 | 1425757 | + | NZ_CP014230.1 | Desulfomicrobium orale DSM 12838 |
| 19 | 3136205 | 3136444 | - | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 20 | 1884625 | 1884894 | - | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 21 | 1879313 | 1879555 | - | NZ_CP025197.1 | Acetivibrio saccincola |
| 22 | 6455008 | 6455262 | + | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 23 | 1945422 | 1945667 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 24 | 2012114 | 2012386 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 25 | 749736 | 750008 | + | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 26 | 768985 | 769257 | + | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 27 | 762766 | 763038 | + | NZ_AP018549.1 | Lactobacillus paragasseri |
| 28 | 4299739 | 4299984 | + | NZ_CP029487.1 | Eubacterium maltosivorans |
| 29 | 1562587 | 1562859 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 30 | 1713057 | 1713302 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 31 | 257403 | 257681 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 32 | 2527247 | 2527495 | - | NZ_CP028842.1 | Clostridium botulinum |
| 33 | 652778 | 653050 | - | NZ_CP012034.1 | Companilactobacillus ginsenosidimutans |
| 34 | 1385412 | 1385672 | - | NC_014216.1 | Desulfurivibrio alkaliphilus AHT 2 |
| 35 | 3727529 | 3727774 | + | NC_020304.1 | Desulfocapsa sulfexigens DSM 10523 |
| 36 | 3907137 | 3907415 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 37 | 1492753 | 1493025 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 38 | 815261 | 815476 | + | NZ_AP014945.1 | Caldimicrobium thiodismutans |
| 39 | 2211647 | 2211892 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 40 | 2789733 | 2789981 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 41 | 1691693 | 1691965 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 42 | 2761507 | 2761752 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 43 | 2673388 | 2673633 | - | NC_014624.2 | Eubacterium callanderi |
| 44 | 3103001 | 3103246 | + | NZ_CP019962.1 | Eubacterium limosum |
| 45 | 387623 | 387889 | - | NZ_CP042909.1 | Thermosulfurimonas marina |
| 46 | 1218070 | 1218342 | + | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 47 | 822000 | 822245 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 48 | 3702069 | 3702329 | + | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 49 | 3746821 | 3747081 | + | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 50 | 1353513 | 1353785 | - | NZ_CP049366.1 | Companilactobacillus pabuli |
| 51 | 1120320 | 1120592 | + | NZ_CP017702.1 | Companilactobacillus farciminis KCTC 3681 = DSM 20184 |
| 52 | 2165528 | 2165800 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 53 | 6750510 | 6750764 | + | NZ_AP021875.1 | Desulfosarcina widdelii |
| 54 | 2826218 | 2826475 | - | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 55 | 851024 | 851266 | + | NZ_CP030777.1 | Faecalibacterium prausnitzii |
| 56 | 956778 | 957050 | - | NZ_CP029476.1 | Lactobacillus apis |
| 57 | 1693559 | 1693834 | - | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 58 | 1173718 | 1173990 | - | NZ_AP019750.1 | Lactobacillus delbrueckii subsp. delbrueckii |
| 59 | 1376469 | 1376741 | - | NZ_CP034234.1 | Erysipelothrix piscisicarius |
| 60 | 1311502 | 1311774 | + | NZ_LR134439.1 | Erysipelothrix rhusiopathiae |
| 61 | 1022091 | 1022363 | + | NZ_CP040736.1 | Companilactobacillus futsaii |
| 62 | 705556 | 705813 | + | NC_015682.1 | Thermodesulfobacterium geofontis OPF15 |
| 63 | 2388257 | 2388529 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 64 | 2093043 | 2093312 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 65 | 1577681 | 1577953 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 66 | 302035 | 302304 | - | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 67 | 579989 | 580234 | - | NZ_CP027226.1 | Fastidiosipila sanguinis |
| 68 | 2496563 | 2496808 | - | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 69 | 1195850 | 1196122 | - | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 70 | 1137960 | 1138232 | - | NZ_CP024610.1 | Lactobacillus terrae |
| 71 | 860978 | 861223 | + | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 72 | 459992 | 460234 | + | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
| 73 | 1688663 | 1688908 | - | NZ_CP014204.2 | Clostridium baratii |
| 74 | 1416853 | 1417101 | - | NC_013385.1 | Ammonifex degensii KC4 |
| 75 | 1309769 | 1310029 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 76 | 1266462 | 1266734 | - | NC_021181.2 | Lactobacillus acidophilus La-14 |
| 77 | 888162 | 888434 | + | NZ_CP059829.1 | Lactobacillus ultunensis |
| 78 | 1794595 | 1794867 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 79 | 2421074 | 2421343 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 80 | 1755054 | 1755326 | + | NZ_CP019323.1 | Companilactobacillus allii |
| 81 | 1554659 | 1554886 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 82 | 1032191 | 1032466 | - | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
| 83 | 551878 | 552147 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 84 | 1108392 | 1108664 | - | NZ_CP029544.1 | Lactobacillus helsingborgensis |
| 85 | 1303560 | 1303820 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 86 | 1307740 | 1308000 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 87 | 1281762 | 1282022 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 88 | 1419265 | 1419525 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 89 | 1068508 | 1068786 | - | NZ_CP045530.1 | Limosilactobacillus pontis |
| 90 | 822070 | 822324 | - | NZ_CP009761.1 | Parvimonas micra |
| 91 | 839248 | 839523 | + | NZ_CP017267.1 | Vagococcus teuberi |
| 92 | 879089 | 879361 | + | NZ_CP017996.1 | Companilactobacillus crustorum |
| 93 | 2599641 | 2599913 | + | NZ_CP026363.1 | Brevibacillus agri |
| 94 | 370811 | 371077 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 95 | 1200262 | 1200507 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 96 | 765128 | 765400 | + | NZ_CP018809.1 | Lactobacillus jensenii |
| 97 | 911691 | 911963 | + | NZ_CP017237.1 | Moorella thermoacetica |
| 98 | 1472664 | 1472921 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 99 | 81771 | 82007 | - | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 100 | 3932203 | 3932457 | + | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 101 | 1717648 | 1717920 | - | NZ_CP016843.1 | Carnobacterium divergens |
| 102 | 1130747 | 1131022 | - | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 103 | 1090720 | 1090965 | + | NC_015520.1 | Mahella australiensis 50-1 BON |
| 104 | 1573841 | 1574086 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 105 | 1653022 | 1653267 | - | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 106 | 1449802 | 1450047 | - | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 107 | 1786397 | 1786642 | - | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 108 | 1022838 | 1023083 | + | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 109 | 1120943 | 1121188 | + | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 110 | 1072990 | 1073235 | + | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 111 | 1425243 | 1425515 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 112 | 774850 | 775092 | - | NZ_HF545616.1 | Ruminococcus bicirculans |
| 113 | 1161445 | 1161690 | + | NZ_CP030775.1 | Clostridium butyricum |
| 114 | 1872404 | 1872649 | - | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 115 | 2591492 | 2591764 | + | NZ_CP037940.1 | Weissella cryptocerci |
| 116 | 1406070 | 1406327 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 117 | 582862 | 583134 | + | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 118 | 918062 | 918337 | + | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 119 | 994348 | 994623 | + | NZ_CP065211.1 | Enterococcus lactis |
| 120 | 1954439 | 1954714 | - | NZ_CP018061.1 | Enterococcus mundtii |
| 121 | 1050187 | 1050459 | - | NZ_CP015444.1 | Lactobacillus helveticus |
| 122 | 845584 | 845856 | + | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 123 | 1040747 | 1041019 | - | NZ_CP017326.1 | Weissella soli |
| 124 | 2129679 | 2129924 | - | NZ_CP009687.1 | Clostridium aceticum |
| 125 | 1020204 | 1020479 | - | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 126 | 1503422 | 1503694 | - | NZ_CP012559.1 | Companilactobacillus heilongjiangensis |
| 127 | 1482970 | 1483227 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 128 | 1573969 | 1574214 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 129 | 1180748 | 1181017 | + | NZ_CP035130.1 | Gudongella oleilytica |
| 130 | 751520 | 751795 | + | NZ_CP023074.1 | Enterococcus thailandicus |
| 131 | 2218014 | 2218256 | - | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 132 | 2486740 | 2487012 | + | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 133 | 3683369 | 3683608 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 134 | 2476360 | 2476635 | - | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 135 | 1221728 | 1221946 | - | NZ_CP027228.1 | Mogibacterium diversum |
| 136 | 1887996 | 1888241 | - | NZ_HG917868.1 | Clostridium bornimense |
| 137 | 2747011 | 2747268 | - | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 138 | 1794948 | 1795220 | - | NZ_AP022822.1 | Enterococcus saigonensis |
| 139 | 1597923 | 1598198 | - | NZ_LS483306.1 | Enterococcus cecorum |
| 140 | 1243999 | 1244274 | - | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 141 | 985556 | 985828 | + | NZ_CP013213.1 | Erysipelothrix larvae |
| 142 | 2343322 | 2343588 | - | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 143 | 552828 | 553103 | + | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 144 | 3088140 | 3088391 | - | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 145 | 1040571 | 1040843 | + | NZ_CP014159.1 | Aerococcus christensenii |
| 146 | 1825607 | 1825879 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 147 | 1841454 | 1841726 | - | NZ_LT906444.1 | Listeria welshimeri |
| 148 | 1922044 | 1922316 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 149 | 1867427 | 1867699 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 150 | 1305413 | 1305658 | + | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 151 | 1276590 | 1276862 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 152 | 580285 | 580530 | + | NC_013895.2 | Mageeibacillus indolicus UPII9-5 |
| 153 | 139482 | 139754 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 154 | 1576561 | 1576836 | + | NZ_CP023011.2 | Enterococcus hirae |
| 155 | 2379027 | 2379272 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 156 | 543866 | 544138 | + | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 157 | 3391499 | 3391759 | - | NZ_CP016757.1 | Cloacibacillus porcorum |
| 158 | 1984683 | 1984955 | + | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 159 | 378312 | 378584 | - | NZ_CP049889.1 | Jeotgalibaca porci |
| 160 | 3160334 | 3160579 | + | NC_006138.1 | Desulfotalea psychrophila LSv54 |
| 161 | 1396390 | 1396635 | + | NZ_CP043998.1 | Clostridium diolis |
| 162 | 1447466 | 1447711 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 163 | 3011824 | 3012084 | + | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 164 | 1708224 | 1708496 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 165 | 1954699 | 1954971 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 166 | 1659203 | 1659475 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 167 | 2546670 | 2546915 | - | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 168 | 617968 | 618240 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 169 | 1278522 | 1278767 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 170 | 508958 | 509230 | + | NZ_CP014161.1 | Aerococcus urinae |
| 171 | 1602146 | 1602421 | - | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 172 | 1140678 | 1140923 | + | NZ_LR134379.1 | Slackia heliotrinireducens |
| 173 | 1802527 | 1802799 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 174 | 1270074 | 1270346 | - | NZ_CP046314.1 | Gemella morbillorum |
| 175 | 932232 | 932504 | + | NZ_LR134484.1 | Gemella haemolysans |
| 176 | 2084337 | 2084597 | + | NC_014758.1 | Calditerrivibrio nitroreducens DSM 19672 |
| 177 | 388211 | 388483 | + | NZ_CP023501.1 | Weissella paramesenteroides |
| 178 | 1439280 | 1439552 | - | NZ_CP014332.1 | Weissella jogaejeotgali |
| 179 | 1039945 | 1040217 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 180 | 3397907 | 3398179 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 181 | 1951167 | 1951439 | + | NZ_CP045875.1 | Heliorestis convoluta |
| 182 | 1145135 | 1145392 | - | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 183 | 2569073 | 2569345 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 184 | 1789139 | 1789411 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 185 | 2540574 | 2540846 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 186 | 2573678 | 2573911 | + | NZ_CP061800.1 | Desulfonema magnum |
| 187 | 188016 | 188261 | - | NZ_CP023671.1 | Clostridium septicum |
| 188 | 3194865 | 3195101 | - | NZ_CP034413.2 | Dysosmobacter welbionis |
| 189 | 2616805 | 2617071 | + | NZ_CP035108.1 | Geovibrio thiophilus |
| 190 | 2789376 | 2789648 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 191 | 1905146 | 1905367 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 192 | 1117729 | 1117986 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 193 | 2221058 | 2221273 | - | NZ_CP048436.1 | Flavonifractor plautii |
| 194 | 2905812 | 2906054 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 195 | 2140720 | 2140968 | - | NZ_CP014223.1 | Anaerotignum propionicum DSM 1682 |
| 196 | 2075809 | 2076054 | + | NZ_CP053187.1 | Turicibacter sanguinis |
| 197 | 2158819 | 2159091 | - | NZ_CP060715.1 | Erysipelothrix inopinata |
| 198 | 821612 | 821851 | - | NZ_CP029256.1 | Christensenella minuta |
| 199 | 1226861 | 1227136 | - | NZ_CP045007.1 | Latilactobacillus graminis |
| 200 | 246831 | 247106 | + | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 201 | 1523766 | 1524041 | + | NZ_CP046037.1 | Latilactobacillus sakei |
| 202 | 747028 | 747300 | + | NZ_CP027563.1 | Weissella confusa |
| 203 | 1166788 | 1167033 | - | NZ_CP016786.1 | Clostridium isatidis |
| 204 | 2573814 | 2574086 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 205 | 1580971 | 1581243 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 206 | 1050783 | 1051055 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 207 | 3619485 | 3619757 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 208 | 3094678 | 3094920 | - | NZ_CP014176.1 | Clostridium argentinense |
| 209 | 1444268 | 1444540 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 210 | 1055240 | 1055497 | + | NZ_LT906477.1 | Clostridium cochlearium |
| 211 | 1302378 | 1302623 | + | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 212 | 3743988 | 3744260 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 213 | 58508 | 58741 | + | NZ_LR130778.1 | Petrocella atlantisensis |
| 214 | 2289809 | 2290054 | + | NC_014393.1 | Clostridium cellulovorans 743B |
| 215 | 1844244 | 1844501 | + | NZ_CP040924.1 | Clostridium thermarum |
| 216 | 2600807 | 2601079 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 217 | 1193246 | 1193503 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 218 | 1487224 | 1487469 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 219 | 2200584 | 2200856 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 220 | 3018416 | 3018688 | + | NZ_CP013661.2 | Planococcus kocurii |
| 221 | 2245125 | 2245397 | - | NZ_CP019401.1 | Planococcus faecalis |
| 222 | 3267210 | 3267482 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 223 | 2009161 | 2009406 | + | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 224 | 1185871 | 1186128 | + | NZ_CP020953.1 | Clostridium drakei |
| 225 | 147144 | 147401 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 226 | 3988732 | 3989004 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 227 | 1706881 | 1707099 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 228 | 2385526 | 2385798 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 229 | 767040 | 767288 | + | NZ_AP019551.1 | Athalassotoga saccharophila |
| 230 | 1573197 | 1573472 | - | NZ_CP034118.1 | Staphylospora marina |
| 231 | 2341193 | 2341465 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 232 | 3625457 | 3625714 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 233 | 1389401 | 1389658 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 234 | 1276027 | 1276296 | + | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 235 | 1431549 | 1431821 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 236 | 2526675 | 2526917 | - | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 237 | 1715734 | 1716000 | - | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 238 | 1169464 | 1169736 | + | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 239 | 579618 | 579893 | + | NC_014011.1 | Aminobacterium colombiense DSM 12261 |
| 240 | 2262743 | 2263009 | - | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 241 | 1810108 | 1810380 | + | NZ_CP015196.1 | Streptococcus marmotae |
| 242 | 2617772 | 2618035 | + | NC_010814.1 | Geobacter lovleyi SZ |
| 243 | 3082079 | 3082336 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 244 | 1050360 | 1050632 | + | NZ_LR134483.1 | Listeria grayi |
| 245 | 2586248 | 2586520 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 246 | 1101243 | 1101515 | - | NZ_LR594050.1 | Streptococcus porcinus |
| 247 | 2078329 | 2078601 | + | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 248 | 1403969 | 1404226 | - | NC_008593.1 | Clostridium novyi NT |
| 249 | 1047034 | 1047309 | + | NZ_AP014680.1 | Paucilactobacillus hokkaidonensis JCM 18461 |
| 250 | 1078788 | 1079060 | + | NZ_AP019309.1 | Intestinibaculum porci |
| 251 | 2111000 | 2111272 | - | NZ_CP016540.2 | Planococcus versutus |
| 252 | 1908539 | 1908811 | - | NZ_CP016953.1 | Streptococcus himalayensis |
| 253 | 573155 | 573427 | - | NZ_CP014163.1 | Aerococcus urinaehominis |
| 254 | 1470522 | 1470764 | + | NZ_CP007514.1 | Rubrobacter radiotolerans |
| 255 | 428025 | 428297 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 256 | 1442448 | 1442705 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 257 | 3505959 | 3506216 | - | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 258 | 667836 | 668111 | + | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 259 | 2567570 | 2567842 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 260 | 1325391 | 1325636 | + | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 261 | 2232953 | 2233198 | - | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 262 | 795857 | 796132 | - | NZ_CP013237.1 | Streptococcus mutans |
| 263 | 854804 | 855076 | + | NZ_CP034543.1 | Streptococcus periodonticum |
| 264 | 6105346 | 6105618 | + | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 265 | 2204819 | 2205064 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 266 | 1778982 | 1779254 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 267 | 2931751 | 2932023 | - | NZ_CP022657.1 | Tumebacillus algifaecis |
| 268 | 790714 | 790980 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 269 | 3915473 | 3915727 | - | NC_013739.1 | Conexibacter woesei DSM 14684 |
| 270 | 894450 | 894725 | + | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 271 | 854024 | 854296 | + | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 272 | 1669966 | 1670238 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 273 | 2097284 | 2097556 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 274 | 2647560 | 2647799 | + | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| 275 | 1459617 | 1459889 | - | NZ_CP031733.1 | Streptococcus chenjunshii |
| 276 | 443624 | 443899 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 277 | 1801592 | 1801864 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 278 | 1800953 | 1801225 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 279 | 1181299 | 1181571 | - | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 280 | 2377977 | 2378228 | - | NC_007759.1 | Syntrophus aciditrophicus SB |
| 281 | 3092246 | 3092506 | + | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| 282 | 858537 | 858809 | + | NZ_LR594046.1 | Streptococcus dysgalactiae |
| 283 | 34052 | 34315 | - | NZ_CP053988.1 | Abiotrophia defectiva |
| 284 | 846447 | 846719 | + | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 285 | 2723118 | 2723390 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 286 | 2595308 | 2595580 | - | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 287 | 2250791 | 2251060 | - | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 288 | 774386 | 774658 | + | NC_012924.1 | Streptococcus suis SC84 |
| 289 | 1473898 | 1474164 | - | NC_013522.1 | Thermanaerovibrio acidaminovorans DSM 6589 |
| 290 | 1501292 | 1501564 | + | NZ_CP040336.1 | Bacillus luti |
| 291 | 3658378 | 3658650 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 292 | 3727923 | 3728195 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 293 | 3862973 | 3863245 | - | NC_011725.1 | Bacillus cereus B4264 |
| 294 | 3867215 | 3867487 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 295 | 1543246 | 1543515 | - | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 296 | 1949917 | 1950189 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 297 | 3277285 | 3277557 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 298 | 1062462 | 1062734 | - | NZ_LS483343.1 | Streptococcus ferus |
| 299 | 5464964 | 5465236 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 300 | 1291877 | 1292152 | - | NZ_AP014612.1 | Streptococcus troglodytae |
| 301 | 2184487 | 2184759 | + | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 302 | 1305721 | 1305993 | - | NZ_LR134512.1 | Streptococcus agalactiae |
| 303 | 1566503 | 1566775 | - | NZ_CP022680.1 | Streptococcus respiraculi |
| 304 | 946274 | 946546 | + | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 305 | 6538059 | 6538319 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
| 306 | 1150607 | 1150879 | - | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 307 | 1012702 | 1012974 | - | NZ_CP032621.1 | Streptococcus gwangjuense |
| 308 | 750889 | 751161 | + | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 309 | 1086292 | 1086564 | - | NZ_AP018400.1 | Streptococcus ruminantium |
| 310 | 1616890 | 1617165 | + | NZ_CP043405.1 | Streptococcus ratti |
| 311 | 3401298 | 3401570 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 312 | 1581302 | 1581574 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 313 | 1711296 | 1711538 | - | NZ_LR215048.1 | Acholeplasma axanthum |
| 314 | 1851982 | 1852254 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 315 | 1677740 | 1678012 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 316 | 1641420 | 1641692 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 317 | 1646491 | 1646763 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 318 | 312234 | 312506 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 319 | 1673620 | 1673892 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 320 | 1857095 | 1857370 | - | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 321 | 1988019 | 1988291 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 322 | 5302114 | 5302362 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 323 | 1036727 | 1036999 | - | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 324 | 1156195 | 1156470 | + | NZ_CP011366.1 | Salinicoccus halodurans |
| 325 | 1972468 | 1972740 | - | NZ_CP016538.2 | Planococcus maritimus |
| 326 | 1995711 | 1995983 | - | NZ_CP059540.1 | Planococcus maritimus |
| 327 | 1768142 | 1768414 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 328 | 1402034 | 1402276 | + | NZ_CP031115.1 | Rubrobacter indicoceani |
| 329 | 1038638 | 1038913 | - | NZ_LT906439.1 | Streptococcus merionis |
| 330 | 4370310 | 4370582 | + | NZ_CP045298.1 | Paenibacillus brasilensis |
| 331 | 3491606 | 3491878 | - | NZ_CP020028.1 | Paenibacillus kribbensis |
| 332 | 3840152 | 3840424 | + | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 333 | 1262692 | 1262964 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 334 | 4813118 | 4813390 | - | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 335 | 410577 | 410798 | - | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 336 | 1103485 | 1103760 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 337 | 1628912 | 1629178 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 338 | 1639759 | 1640025 | + | NC_011979.1 | Geobacter daltonii FRC-32 |
| 339 | 1377921 | 1378169 | - | NZ_CP021255.1 | Desulfobulbus oralis |
| 340 | 948642 | 948914 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 341 | 268653 | 268889 | + | NC_022538.1 | Acholeplasma palmae J233 |
| 342 | 1338828 | 1339070 | + | NZ_CP032364.1 | Lachnoanaerobaculum umeaense |
| 343 | 1097341 | 1097613 | + | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 344 | 1714546 | 1714818 | + | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 345 | 766332 | 766604 | + | NZ_CP019981.1 | Pediococcus inopinatus |
| 346 | 675145 | 675393 | + | NZ_LT906470.1 | Veillonella rodentium |
| 347 | 73251 | 73496 | - | NZ_CP067016.1 | Anaerococcus obesiensis |
| 348 | 1351561 | 1351806 | - | NZ_CP066014.1 | Anaerococcus vaginalis |
| 349 | 1609684 | 1609950 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 350 | 1479389 | 1479634 | - | NC_022549.1 | Acholeplasma brassicae |
| 351 | 514508 | 514726 | - | NC_014314.1 | Dehalogenimonas lykanthroporepellens BL-DC-9 |
| 352 | 895356 | 895628 | + | NZ_CP053421.1 | Pediococcus acidilactici |
| 353 | 855375 | 855647 | + | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 354 | 3861799 | 3862065 | - | NZ_AP023213.1 | Citrifermentans bremense |
| 355 | 3943249 | 3943515 | - | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 356 | 1027706 | 1027978 | + | NZ_CP014167.1 | Paenibacillus yonginensis |
| 357 | 1007617 | 1007892 | + | NZ_CP047361.1 | Macrococcus canis |
| 358 | 1084351 | 1084617 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 359 | 712951 | 713226 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 360 | 1491139 | 1491387 | - | NZ_LR778174.1 | Veillonella parvula |
| 361 | 137787 | 138041 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 362 | 1379587 | 1379835 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 363 | 1432476 | 1432724 | - | NZ_LR134375.1 | Veillonella dispar |
| 364 | 1712062 | 1712337 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 365 | 1206135 | 1206407 | - | NZ_CP032627.1 | Lactococcus allomyrinae |
| 366 | 2890617 | 2890889 | - | NZ_CP014150.1 | Paeniclostridium sordellii |
| 367 | 894172 | 894444 | + | NZ_CP012805.1 | Streptococcus anginosus |
| 368 | 854672 | 854947 | + | NZ_CP047141.1 | Ligilactobacillus animalis |
| 369 | 2676718 | 2676966 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 370 | 1537934 | 1538209 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 371 | 1951132 | 1951404 | + | NZ_CP012294.1 | Pediococcus damnosus |
| 372 | 3434178 | 3434450 | + | NZ_CP021434.1 | Tumebacillus avium |
| 373 | 1461538 | 1461804 | - | NZ_CP065712.1 | Staphylococcus auricularis |
| 374 | 2801986 | 2802249 | - | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 375 | 731811 | 732053 | + | NZ_CP009302.1 | Berryella intestinalis |
| 376 | 2595525 | 2595785 | - | NC_007498.2 | Syntrophotalea carbinolica DSM 2380 |
| 377 | 3084724 | 3084966 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 378 | 1011486 | 1011761 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 379 | 917265 | 917531 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 380 | 691678 | 691953 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 381 | 1460327 | 1460602 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 382 | 1243810 | 1244052 | - | NC_010163.1 | Acholeplasma laidlawii PG-8A |
| 383 | 1026830 | 1027072 | + | NZ_CP011402.1 | Denitrobacterium detoxificans |
| 384 | 1704919 | 1705185 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 385 | 93088 | 93363 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 386 | 890130 | 890405 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 387 | 1227347 | 1227607 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
| 388 | 2577967 | 2578212 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 389 | 1276739 | 1276945 | + | NC_014926.1 | Thermovibrio ammonificans HB-1 |
| 390 | 970950 | 971228 | - | NZ_CP019573.1 | Abyssicoccus albus |
| 391 | 987805 | 988050 | + | NZ_LT635772.1 | Anaerococcus mediterraneensis |
| 392 | 1665643 | 1665918 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 393 | 1727420 | 1727695 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 394 | 2083001 | 2083276 | + | NC_020520.1 | Ilumatobacter coccineus YM16-304 |
| 395 | 857619 | 857894 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 396 | 2250415 | 2250663 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 397 | 558896 | 559171 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 398 | 585670 | 585918 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 399 | 3531837 | 3532082 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 400 | 1230265 | 1230540 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 401 | 1159735 | 1160010 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 402 | 1604661 | 1604936 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 403 | 2375974 | 2376249 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 404 | 1706633 | 1706908 | + | NZ_CP027770.1 | Staphylococcus felis |
| 405 | 4139676 | 4139930 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 406 | 1185586 | 1185861 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 407 | 541258 | 541533 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 408 | 2338609 | 2338815 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 409 | 1720390 | 1720638 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 410 | 2221223 | 2221498 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 411 | 397824 | 398069 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 412 | 192551 | 192817 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 413 | 3216693 | 3216932 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 414 | 389926 | 390177 | + | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 415 | 35569 | 35820 | - | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 416 | 5838242 | 5838490 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 417 | 1025450 | 1025698 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 418 | 4498797 | 4499048 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP021850.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01782.20 | 0.89 | 372 | 341 | same-strand | RimM N-terminal domain |
| 2 | PF05239.18 | 0.85 | 352 | 351.0 | same-strand | PRC-barrel domain |
| 3 | PF13083.8 | 0.86 | 357 | 19 | same-strand | KH domain |
| 4 | PF00448.24 | 0.85 | 353 | 143 | same-strand | SRP54-type protein, GTPase domain |
| 5 | PF02978.21 | 0.85 | 353 | 90 | same-strand | Signal peptide binding domain |
| 6 | PF02881.21 | 0.85 | 353 | 142.0 | same-strand | SRP54-type protein, helical bundle domain |
| 7 | PF01746.23 | 0.88 | 364 | 852.0 | same-strand | tRNA (Guanine-1)-methyltransferase |
| 8 | PF01245.22 | 0.74 | 307 | 1799 | same-strand | Ribosomal protein L19 |
| 9 | PF04297.16 | 0.66 | 276 | 1465 | same-strand | Putative helix-turn-helix protein, YlxM / p13 like |
++ More..