Result : EXP03210

Protein Information

• Protein name: EXP03210
• Organism: Bacteroides,Alistipes
• Nucleotide Sequence: ATGGAACATTTGAATCCTGTTGATCAGGCCCGGCAATTGGCTGCCGAGGTAGTGAAACGTCTGGGCCAGTTGAATCTGCACAGACGGGAGTTGGAGCGTAAGCTCCATGTGGCTAATGGCTTTTTTACCAGCTTGGAAGAAAAAAAATAA
• Sequence: MEHLNPVDQARQLAAEVVKRLGQLNLHRRELERKLHVANGFFTSLEEKK
• Source of smORF: Metagenomic Ribo-seq
• Pubmed ID: 32601270
• Functional Category: Function not yet assigned
• ORF Length (Amino Acid): 49

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	4070089	4070238	+	NZ_LR699004.1	Phocaeicola dorei
2	3760708	3760857	+	NC_009614.1	Phocaeicola vulgatus ATCC 8482

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_LR699004.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF18291.3	1.0	2	3554.5	opposite-strand	HU domain fused to wHTH, Ig, or Glycine-rich motif
2	PF14848.8	1.0	2	3554.5	opposite-strand	DNA-binding domain
3	PF14053.8	1.0	2	2990.5	opposite-strand	Domain of unknown function (DUF4248)
4	PF13148.8	1.0	2	893.0	opposite-strand	Protein of unknown function (DUF3987)
5	PF08707.13	1.0	2	893.0	opposite-strand	Primase C terminal 2 (PriCT-2)
6	PF08800.12	1.0	2	159.5	opposite-strand	VirE N-terminal domain
7	PF00271.33	1.0	2	1719.0	same-strand	Helicase conserved C-terminal domain