Protein Information |
Information Type | Description |
---|---|
Protein name | EXP03203 |
NCBI Accession ID | |
Organism | Desulfotomaculum |
Left | |
Right | |
Strand | |
Nucleotide Sequence | ATGAGAAAGGGATATCTTGTTGATTCGGGCTACATGGGGTATATTCCTGATTCCCATGAGTATCTTTTATTTGCTTCTGAATCTGATTATGATGAATTTATGATGGATATTTAA |
Sequence | MRKGYLVDSGYMGYIPDSHEYLLFASESDYDEFMMDI |
Source of smORF | Metagenomic Ribo-seq |
Function | |
Pubmed ID | 32601270 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 37 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1924349 | 1924453 | + | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
2 | 1615130 | 1615231 | + | NZ_LT990039.1 | Massilistercora timonensis |
3 | 2171581 | 2171682 | - | NZ_LR699011.1 | Roseburia hominis |
4 | 2771804 | 2771905 | - | NZ_LT635479.1 | Lachnoclostridium phocaeense |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00005.29 | 0.75 | 3 | 3342 | same-strand | ABC transporter |
2 | PF13280.8 | 0.75 | 3 | 84 | same-strand | WYL domain |