Result : EXP03203
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03203 |
| NCBI Accession ID | |
| Organism | Desulfotomaculum |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGAGAAAGGGATATCTTGTTGATTCGGGCTACATGGGGTATATTCCTGATTCCCATGAGTATCTTTTATTTGCTTCTGAATCTGATTATGATGAATTTATGATGGATATTTAA |
| Sequence | MRKGYLVDSGYMGYIPDSHEYLLFASESDYDEFMMDI |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 37 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1924349 | 1924453 | + | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 2 | 1615130 | 1615231 | + | NZ_LT990039.1 | Massilistercora timonensis |
| 3 | 2171581 | 2171682 | - | NZ_LR699011.1 | Roseburia hominis |
| 4 | 2771804 | 2771905 | - | NZ_LT635479.1 | Lachnoclostridium phocaeense |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP036170.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 0.75 | 3 | 3342 | same-strand | ABC transporter |
| 2 | PF13280.8 | 0.75 | 3 | 84 | same-strand | WYL domain |
++ More..