Result : EXP03190

Protein Information

• Protein name: EXP03190
• Organism: Bacteroides
• Nucleotide Sequence: ATGGGCAGAGAACTTATATTTGACCGGTTTTCGCAGCAGGCTCTCCAGACCTTGCACCGGTATCGTGCCGTTATGTTCAGTCCTACGATGCTCATGTCTTTGGTTGTTTNCNNATGA
• Sequence: MGRELIFDRFSQQALQTLHRYRAVMFSPTMLMSLVVXX
• Source of smORF: Metagenomic Ribo-seq
• Pubmed ID: 32601270
• Functional Category: Function not yet assigned
• ORF Length (Amino Acid): 38

Conservation Analysis

No. of Species: 3

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	4472536	4472652	-	NC_009614.1	Phocaeicola vulgatus ATCC 8482
2	4816258	4816383	-	NZ_LR699004.1	Phocaeicola dorei
3	4156326	4156424	-	NZ_LN877293.1	Bacteroides fragilis

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_LR699004.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00171.24	0.67	2	38.0	same-strand	Aldehyde dehydrogenase family
2	PF01619.20	0.67	2	38.0	same-strand	Proline dehydrogenase
3	PF01894.19	0.67	2	1143.5	same-strand	Uncharacterised protein family UPF0047
4	PF00005.29	0.67	2	2764.5	same-strand	ABC transporter
5	PF16120.7	0.67	2	3405.5	same-strand	Domain of unknown function (DUF4836)
6	PF08281.14	0.67	2	4070.0	both-strands	Sigma-70, region 4
7	PF04542.16	0.67	2	4070.0	both-strands	Sigma-70 region 2
8	PF04545.18	0.67	2	4070.0	both-strands	Sigma-70, region 4