Result : EXP03189
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03189 |
| NCBI Accession ID | |
| Organism | Bacteroides |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGCAGTTTTTAGAAAGCGTTGTGATTTGCTTTCGAATTAGTATCTTTGAACCATTGAAAACAACCACGGATGTGGCTTACAACATGGTTTATTGTTGTGATTTGCTTTCGAATTAG |
| Sequence | MQFLESVVICFRISIFEPLKTTTDVAYNMVYCCDLLSN |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 38 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1786918 | 1787013 | + | NZ_CP027234.1 | Bacteroides heparinolyticus |
| 2 | 2526135 | 2526230 | + | NZ_CP054012.1 | Parabacteroides distasonis |
| 3 | 2526595 | 2526690 | + | NZ_CP054012.1 | Parabacteroides distasonis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP027234.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09827.11 | 1.0 | 2 | 209 | opposite-strand | CRISPR associated protein Cas2 |
| 2 | PF01867.18 | 1.0 | 2 | 543 | opposite-strand | CRISPR associated protein Cas1 |
| 3 | PF18541.3 | 1.0 | 2 | 2047 | opposite-strand | RuvC endonuclease subdomain 3 |
| 4 | PF13395.8 | 1.0 | 2 | 2047 | opposite-strand | HNH endonuclease |
++ More..