Result : B8HRF1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Photosystem I reaction center subunit VIII |
| NCBI Accession ID | CP001344.1 |
| Organism | Cyanothece sp. (strain PCC 7425 / ATCC 29141) |
| Left | 1620452 |
| Right | 1620577 |
| Strand | + |
| Nucleotide Sequence | ATGACCGGCTCCTACGCTGCTTCCTTTTTACCCTGGATCATGATTCCAGTTACCTGCTGGTTATTTCCCGTGGTCGTTATGGGTTTACTCTTTATCTACATTGAGAGCGATGCCCCTTCTACCTAG |
| Sequence | MTGSYAASFLPWIMIPVTCWLFPVVVMGLLFIYIESDAPST |
| Source of smORF | Swiss-Prot |
| Function | May help in the organization of the PsaL subunit. {ECO:0000255|HAMAP-Rule:MF_00431}. |
| Pubmed ID | 21972240 |
| Domain | CDD:279175,CDD:355705 |
| Functional Category | Others |
| Uniprot ID | B8HRF1 |
| ORF Length (Amino Acid) | 41 |
++ More..
| Conservation Analysis |
No. of Species: 16
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 878081 | 878197 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 2 | 2486746 | 2486862 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 3 | 891366 | 891488 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 4 | 4043897 | 4044013 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 5 | 3261740 | 3261856 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 6 | 4028719 | 4028835 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 7 | 1432786 | 1432914 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 8 | 2518039 | 2518155 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 9 | 756894 | 757010 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 10 | 4956373 | 4956489 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 11 | 2783313 | 2783429 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 12 | 447994 | 448110 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 13 | 4232607 | 4232723 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 14 | 3371413 | 3371529 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 15 | 1137829 | 1137975 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 16 | 2181967 | 2182086 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 17 | 3778995 | 3779114 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_019729.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02605.17 | 1.0 | 16 | 62.0 | same-strand | Photosystem I reaction centre subunit XI |
++ More..