Protein Information |
Information Type | Description |
---|---|
Protein name | Photosystem I reaction center subunit VIII |
NCBI Accession ID | CP001344.1 |
Organism | Cyanothece sp. (strain PCC 7425 / ATCC 29141) |
Left | 1620452 |
Right | 1620577 |
Strand | + |
Nucleotide Sequence | ATGACCGGCTCCTACGCTGCTTCCTTTTTACCCTGGATCATGATTCCAGTTACCTGCTGGTTATTTCCCGTGGTCGTTATGGGTTTACTCTTTATCTACATTGAGAGCGATGCCCCTTCTACCTAG |
Sequence | MTGSYAASFLPWIMIPVTCWLFPVVVMGLLFIYIESDAPST |
Source of smORF | Swiss-Prot |
Function | May help in the organization of the PsaL subunit. {ECO:0000255|HAMAP-Rule:MF_00431}. |
Pubmed ID | 21972240 |
Domain | CDD:279175,CDD:355705 |
Functional Category | Others |
Uniprot ID | B8HRF1 |
ORF Length (Amino Acid) | 41 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 878081 | 878197 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
2 | 2486746 | 2486862 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
3 | 891366 | 891488 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
4 | 4043897 | 4044013 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
5 | 3261740 | 3261856 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
6 | 4028719 | 4028835 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
7 | 1432786 | 1432914 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
8 | 2518039 | 2518155 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
9 | 756894 | 757010 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
10 | 4956373 | 4956489 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
11 | 2783313 | 2783429 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
12 | 447994 | 448110 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
13 | 4232607 | 4232723 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
14 | 3371413 | 3371529 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
15 | 1137829 | 1137975 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
16 | 2181967 | 2182086 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
17 | 3778995 | 3779114 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02605.17 | 1.0 | 16 | 62.0 | same-strand | Photosystem I reaction centre subunit XI |