Result : EXP03170
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03170 |
| NCBI Accession ID | |
| Organism | Stomatobaculum |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | GTGAGTCATGAGAAAGGCGAGGCGGTTGTCGAGCTGAGCAAAGAGGTCAGCGACGAGACGCTCAAGCAGGCAGTTGAAGAGAAGGACTATGAGGTGACCGGCGTTAAGAGTCTCTGA |
| Sequence | MSHEKGEAVVELSKEVSDETLKQAVEEKDYEVTGVKSL |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 38 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 764249 | 764377 | + | NZ_LR699011.1 | Roseburia hominis |
| 2 | 1061194 | 1061319 | - | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 3 | 1351682 | 1351807 | - | NZ_CP030777.1 | Faecalibacterium prausnitzii |
| 4 | 2634210 | 2634335 | + | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 5 | 1347988 | 1348098 | - | NZ_LT990039.1 | Massilistercora timonensis |
| 6 | 2134454 | 2134591 | + | NZ_LT996885.1 | Dialister massiliensis |
| 7 | 3559059 | 3559169 | + | NZ_CP016757.1 | Cloacibacillus porcorum |
| 8 | 2610351 | 2610461 | + | NC_014734.1 | Paludibacter propionicigenes WB4 |
| 9 | 1012767 | 1012877 | + | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 10 | 2119864 | 2119989 | - | NZ_AP019309.1 | Intestinibaculum porci |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR699011.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02583.19 | 0.7 | 7 | 2465 | same-strand | Metal-sensitive transcriptional repressor |
++ More..