Result : B8HMR2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L29 |
| NCBI Accession ID | CP001344.1 |
| Organism | Cyanothece sp. (strain PCC 7425 / ATCC 29141) |
| Left | 1133118 |
| Right | 1133342 |
| Strand | + |
| Nucleotide Sequence | ATGGCCCTCTCAAAGATGAAAGATCTGCTCGACCTTAGTGATGCAGAAGTAGAAACTCAAATCCTGGACCTGAAGCGACAATTGTTTCAGTTGCGCTTACAGAAGGCTACTCGGCAGGAAGTGAAGCCCCATCAGTTTAAGCATCTCCGCCATCAACTAGCCCAACTGATGACGCTGGAGCGGCAACGACAATTAACCCAGCAACAGACCTCAGTGCAGGAGTAA |
| Sequence | MALSKMKDLLDLSDAEVETQILDLKRQLFQLRLQKATRQEVKPHQFKHLRHQLAQLMTLERQRQLTQQQTSVQE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09943. Profile Description: N/A. This family represents the N-terminal region (approximately 8 residues) of the eukaryotic mitochondrial 39-S ribosomal protein L47 (MRP-L47). Mitochondrial ribosomal proteins (MRPs) are the counterparts of the cytoplasmic ribosomal proteins, in that they fulfil similar functions in protein biosynthesis. However, they are distinct in number, features and primary structure. |
| Pubmed ID | 21972240 |
| Domain | CDD:415815 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B8HMR2 |
| ORF Length (Amino Acid) | 74 |
++ More..
| Conservation Analysis |
No. of Species: 22
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2470913 | 2471125 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 2 | 77699 | 77911 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 3 | 61584 | 61796 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 4 | 5189658 | 5189864 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 5 | 2669021 | 2669248 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
| 6 | 4468984 | 4469211 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 7 | 4140614 | 4140844 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 8 | 3394194 | 3394418 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 9 | 6148686 | 6148913 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 10 | 5627737 | 5627964 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 11 | 174242 | 174469 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 12 | 4000279 | 4000506 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 13 | 4733660 | 4733854 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 14 | 5461982 | 5462209 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 15 | 217184 | 217417 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 16 | 2618214 | 2618456 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 17 | 6461500 | 6461715 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
| 18 | 5491608 | 5491853 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 19 | 4115144 | 4115356 | - | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 20 | 2171016 | 2171240 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 21 | 2780310 | 2780522 | - | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 22 | 5287593 | 5287811 | - | NC_010296.1 | Microcystis aeruginosa NIES-843 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP018202.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00410.21 | 0.91 | 20 | 1706.0 | same-strand | Ribosomal protein S8 |
| 2 | PF00673.23 | 1.0 | 22 | 1126.0 | same-strand | ribosomal L5P family C-terminus |
| 3 | PF00281.21 | 1.0 | 22 | 1126.0 | same-strand | Ribosomal protein L5 |
| 4 | PF17136.6 | 1.0 | 22 | 669.5 | same-strand | Ribosomal proteins 50S L24/mitochondrial 39S L24 |
| 5 | PF00467.31 | 1.0 | 22 | 669.5 | same-strand | KOW motif |
| 6 | PF00238.21 | 1.0 | 22 | 301.0 | same-strand | Ribosomal protein L14p/L23e |
| 7 | PF00366.22 | 1.0 | 22 | 7.0 | same-strand | Ribosomal protein S17 |
| 8 | PF00252.20 | 1.0 | 22 | 4.0 | same-strand | Ribosomal protein L16p/L10e |
| 9 | PF00189.22 | 1.0 | 22 | 510.0 | same-strand | Ribosomal protein S3, C-terminal domain |
| 10 | PF07650.19 | 1.0 | 22 | 510.0 | same-strand | KH domain |
| 11 | PF00237.21 | 1.0 | 22 | 1316.5 | same-strand | Ribosomal protein L22p/L17e |
| 12 | PF00203.23 | 0.91 | 20 | 1771.5 | same-strand | Ribosomal protein S19 |
| 13 | PF03947.20 | 0.91 | 20 | 2166.0 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 14 | PF00181.25 | 0.91 | 20 | 2166.0 | same-strand | Ribosomal Proteins L2, RNA binding domain |
++ More..