| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03155 |
| NCBI Accession ID | |
| Organism | Escherichia |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGTCTAAAGGTAAAAAACGTTCTGGCGCTCGCCCTGGTCGTCCGCAGCCGTTGCGAGGTACTAAAGGCAAGCGTACAGGCGCTCGTCTTTGGTATGTAGGTGGTCAACAATTTTAA |
| Sequence | MSKGKKRSGARPGRPQPLRGTKGKRTGARLWYVGGQQF |
| Source of smORF | Metagenomic Ribo-seq |
| Function | The ORF matches to the profile of PHA00008. Profile Description: DNA packaging protein The ORF matches to the profile of pfam04726. Profile Description: Microvirus J protein. This small protein is involved in DNA packaging, interacting with DNA via its hydrophobic carboxyl terminus. In bacteriophage phi-X174, J is present in 60 copies, and forms an S-shaped polypeptide chain without any secondary structure. It is thought to interact with DNA through simple charge interactions. |
| Pubmed ID | 32601270 |
| Domain | CDD:282569,CDD:222770 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 38 |