Protein Information |
Information Type | Description |
---|---|
Protein name | EXP03155 |
NCBI Accession ID | |
Organism | Escherichia |
Left | |
Right | |
Strand | |
Nucleotide Sequence | ATGTCTAAAGGTAAAAAACGTTCTGGCGCTCGCCCTGGTCGTCCGCAGCCGTTGCGAGGTACTAAAGGCAAGCGTACAGGCGCTCGTCTTTGGTATGTAGGTGGTCAACAATTTTAA |
Sequence | MSKGKKRSGARPGRPQPLRGTKGKRTGARLWYVGGQQF |
Source of smORF | Metagenomic Ribo-seq |
Function | The ORF matches to the profile of PHA00008. Profile Description: DNA packaging protein The ORF matches to the profile of pfam04726. Profile Description: Microvirus J protein. This small protein is involved in DNA packaging, interacting with DNA via its hydrophobic carboxyl terminus. In bacteriophage phi-X174, J is present in 60 copies, and forms an S-shaped polypeptide chain without any secondary structure. It is thought to interact with DNA through simple charge interactions. |
Pubmed ID | 32601270 |
Domain | CDD:282569,CDD:222770 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 38 |