Result : EXP03153
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03153 |
| NCBI Accession ID | |
| Organism | |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGCTTCAGGATCTTATCATCAGCGGTGTAAACGAGATTCTCAAGGAAGTTGATGATTACGGCGCAGCTGAGATGGAAAAGGTTACCGGCGGCGTTTCCTTCCCCGGCTTCATCTGA |
| Sequence | MLQDLIISGVNEILKEVDDYGAAEMEKVTGGVSFPGFI |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 38 |
++ More..
| Conservation Analysis |
No. of Species: 86
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 48469 | 48585 | + | NZ_CP013019.1 | Clostridium pasteurianum |
| 2 | 176497 | 176613 | + | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 3 | 4035427 | 4035543 | - | NZ_CP019870.1 | Clostridioides difficile |
| 4 | 21772 | 21888 | + | NZ_CP014150.1 | Paeniclostridium sordellii |
| 5 | 4399106 | 4399222 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 6 | 4651653 | 4651769 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 7 | 200904 | 201017 | - | NC_020813.1 | Bdellovibrio exovorus JSS |
| 8 | 340071 | 340187 | + | NC_010814.1 | Geobacter lovleyi SZ |
| 9 | 464044 | 464160 | + | NC_007498.2 | Syntrophotalea carbinolica DSM 2380 |
| 10 | 3609189 | 3609305 | + | NC_005363.1 | Bdellovibrio bacteriovorus HD100 |
| 11 | 221302 | 221418 | + | NZ_CP035130.1 | Gudongella oleilytica |
| 12 | 108790 | 108906 | + | NC_002939.5 | Geobacter sulfurreducens PCA |
| 13 | 961038 | 961154 | - | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 14 | 5501662 | 5501778 | + | NZ_CP020953.1 | Clostridium drakei |
| 15 | 82253 | 82369 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 16 | 2344698 | 2344814 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 17 | 53668 | 53784 | + | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 18 | 606817 | 606933 | - | NZ_CP009240.1 | Megasphaera elsdenii 14-14 |
| 19 | 248802 | 248918 | - | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 20 | 1600418 | 1600534 | - | NZ_CP028102.1 | Fusobacterium mortiferum ATCC 9817 |
| 21 | 201693 | 201809 | - | NZ_CP028105.1 | Fusobacterium ulcerans |
| 22 | 138367 | 138480 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 23 | 3272485 | 3272601 | - | NZ_CP028103.1 | Fusobacterium varium ATCC 27725 |
| 24 | 1389812 | 1389928 | - | NZ_CP029462.1 | Megasphaera stantonii |
| 25 | 2444171 | 2444287 | + | NZ_CP045875.1 | Heliorestis convoluta |
| 26 | 45423 | 45539 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 27 | 2797587 | 2797703 | - | NZ_CP048649.1 | Aminipila butyrica |
| 28 | 21910 | 22026 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 29 | 847214 | 847330 | - | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 30 | 298616 | 298732 | - | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 31 | 34013 | 34129 | + | NZ_LT906477.1 | Clostridium cochlearium |
| 32 | 240276 | 240392 | - | NZ_AP023213.1 | Citrifermentans bremense |
| 33 | 2505447 | 2505563 | - | NC_008593.1 | Clostridium novyi NT |
| 34 | 1906879 | 1906995 | - | NC_013740.1 | Acidaminococcus fermentans DSM 20731 |
| 35 | 3838624 | 3838740 | - | NC_007517.1 | Geobacter metallireducens GS-15 |
| 36 | 2627406 | 2627522 | - | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 37 | 1287200 | 1287319 | - | NZ_CP027228.1 | Mogibacterium diversum |
| 38 | 3380804 | 3380929 | - | NZ_AP014924.1 | Limnochorda pilosa |
| 39 | 1483450 | 1483581 | - | NZ_AP014945.1 | Caldimicrobium thiodismutans |
| 40 | 1303064 | 1303180 | + | NZ_LT828648.1 | Nitrospira japonica |
| 41 | 50754 | 50870 | + | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 42 | 1866915 | 1867034 | - | NZ_LR134375.1 | Veillonella dispar |
| 43 | 1900670 | 1900789 | - | NZ_LR778174.1 | Veillonella parvula |
| 44 | 1829042 | 1829161 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 45 | 273185 | 273304 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 46 | 3443717 | 3443833 | - | NZ_CP009788.1 | Geobacter pickeringii |
| 47 | 2972664 | 2972792 | + | NC_017956.1 | Tistrella mobilis KA081020-065 |
| 48 | 2125800 | 2125916 | - | NC_014836.1 | Desulfurispirillum indicum S5 |
| 49 | 979765 | 979896 | + | NC_015682.1 | Thermodesulfobacterium geofontis OPF15 |
| 50 | 1837399 | 1837518 | - | NZ_LT906470.1 | Veillonella rodentium |
| 51 | 35909 | 36025 | + | NZ_CP024955.1 | Kyrpidia spormannii |
| 52 | 1553499 | 1553615 | + | NZ_CP061800.1 | Desulfonema magnum |
| 53 | 41193 | 41312 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 54 | 36913 | 37029 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 55 | 1186989 | 1187105 | + | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 56 | 1716248 | 1716367 | + | NZ_AP018449.1 | Methylomusa anaerophila |
| 57 | 1416717 | 1416836 | - | NZ_LT906446.1 | Megamonas hypermegale |
| 58 | 2505919 | 2506047 | - | NZ_CP050139.1 | Komagataeibacter rhaeticus |
| 59 | 153419 | 153538 | + | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 60 | 141686 | 141802 | + | NZ_CP029256.1 | Christensenella minuta |
| 61 | 4620718 | 4620837 | - | NZ_CP036259.1 | Sporomusa termitida |
| 62 | 28059 | 28178 | + | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 63 | 15852 | 15971 | + | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 64 | 3305249 | 3305368 | - | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 65 | 4417513 | 4417632 | - | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 66 | 5810188 | 5810286 | + | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 67 | 2142120 | 2142248 | - | NZ_CP060244.1 | Entomobacter blattae |
| 68 | 341459 | 341578 | + | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 69 | 2194863 | 2194976 | - | NZ_CP008876.1 | Terribacillus goriensis |
| 70 | 311752 | 311856 | + | NZ_CP045007.1 | Latilactobacillus graminis |
| 71 | 1258673 | 1258777 | - | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 72 | 1240262 | 1240372 | + | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 73 | 1719686 | 1719796 | - | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 74 | 616558 | 616668 | + | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 75 | 1187023 | 1187133 | + | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 76 | 1504221 | 1504322 | - | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 77 | 1047241 | 1047342 | + | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 78 | 1615369 | 1615479 | - | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 79 | 1140867 | 1140971 | + | NZ_CP046037.1 | Latilactobacillus sakei |
| 80 | 162008 | 162121 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 81 | 3645210 | 3645317 | + | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 82 | 2668006 | 2668122 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 83 | 436974 | 437075 | + | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 84 | 398794 | 398895 | + | NZ_AP018549.1 | Lactobacillus paragasseri |
| 85 | 389498 | 389599 | + | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 86 | 488609 | 488716 | + | NZ_CP039712.1 | Vagococcus zengguangii |
| 87 | 2223700 | 2223804 | + | NC_013192.1 | Leptotrichia buccalis C-1013-b |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013019.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13177.8 | 0.85 | 73 | 268.5 | same-strand | DNA polymerase III, delta subunit |
| 2 | PF12169.10 | 0.83 | 71 | 265 | same-strand | DNA polymerase III subunits gamma and tau domain III |
| 3 | PF00004.31 | 0.85 | 73 | 266.5 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 4 | PF13662.8 | 0.94 | 81 | 19 | same-strand | Toprim domain |
| 5 | PF02132.17 | 0.94 | 81 | 19 | same-strand | RecR protein |
| 6 | PF01751.24 | 0.88 | 76 | 19.0 | same-strand | Toprim domain |
++ More..