Protein Information |
Information Type | Description |
---|---|
Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
NCBI Accession ID | AM406670.1 |
Organism | Azoarcus sp. (strain BH72) |
Left | 1293493 |
Right | 1293747 |
Strand | - |
Nucleotide Sequence | ATGCCCAAGCCGGCGTCATCGCCCACCTCCTTCGAAGCCGCCGTCGCCGAGCTGGAAACCATCGTGCAACAGATGGAATCCGGCCAGCTCAGCCTCGAAGACGCGTTGGCGCGCTACCAGCGGGGCGTCGGCCTGCTGAAGTTCTGCCAGGAAACGCTGAGCGGCGCCGAACAGCGCATCCGCCAGCTCGAAGGCGGCGAACTCGTCGAGCTGCGCATCGACACCAATGCCGACGGCAGCCAGGAGTGCGCATGA |
Sequence | MPKPASSPTSFEAAVAELETIVQQMESGQLSLEDALARYQRGVGLLKFCQETLSGAEQRIRQLEGGELVELRIDTNADGSQECA |
Source of smORF | Swiss-Prot |
Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
Pubmed ID | 17057704 |
Domain | CDD:412547 |
Functional Category | Others |
Uniprot ID | A1K4R2 |
ORF Length (Amino Acid) | 84 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1376811 | 1377065 | - | NZ_CP016210.1 | Azoarcus olearius |
2 | 479344 | 479601 | - | NZ_CP014646.1 | Thauera humireducens |
3 | 1235125 | 1235370 | + | NZ_CP059560.1 | Aromatoleum petrolei |
4 | 2175709 | 2175948 | + | NZ_CP029331.1 | Thauera hydrothermalis |
5 | 2632503 | 2632748 | - | NC_006513.1 | Aromatoleum aromaticum EbN1 |
6 | 3017554 | 3017799 | - | NZ_CP059467.1 | Aromatoleum bremense |
7 | 2487472 | 2487705 | + | NZ_CP025682.1 | Azoarcus pumilus |
8 | 1759478 | 1759738 | - | NZ_CP028339.1 | Thauera aromatica K172 |
9 | 1313895 | 1314149 | + | NZ_AP022853.1 | Sulfurimicrobium lacus |
10 | 3380344 | 3380577 | - | NZ_CP041335.1 | Chitinolyticbacter meiyuanensis |
11 | 996878 | 997120 | - | NZ_LR778301.1 | Denitratisoma oestradiolicum |
12 | 1542492 | 1542746 | + | NZ_CP013341.1 | Nitrosomonas ureae |
13 | 895185 | 895394 | + | NZ_CP016022.1 | Ralstonia insidiosa |
14 | 1255401 | 1255634 | - | NZ_CP047241.1 | Aquitalea denitrificans |
15 | 4049180 | 4049413 | + | NZ_CP039731.1 | Aquitalea aquatilis |
16 | 705627 | 705872 | + | NC_013959.1 | Sideroxydans lithotrophicus ES-1 |
17 | 1706423 | 1706668 | + | NZ_AP021881.1 | Sulfuriferula nivalis |
18 | 2717840 | 2718052 | + | NZ_CP058952.1 | Chitinibacter fontanus |
19 | 1813380 | 1813586 | + | NZ_CP068285.1 | Ralstonia syzygii subsp. celebesensis |
20 | 2666565 | 2666774 | - | NZ_CP032519.1 | Cupriavidus oxalaticus |
21 | 2786351 | 2786626 | + | NZ_AP012547.1 | Sulfuritalea hydrogenivorans sk43H |
22 | 1618220 | 1618459 | - | NZ_CP009793.1 | Burkholderia dolosa AU0158 |
23 | 840548 | 840787 | + | NZ_CP013403.1 | Burkholderia metallica |
24 | 934519 | 934740 | + | NZ_CP013452.1 | Burkholderia cenocepacia |
25 | 205735 | 205956 | - | NZ_CP011504.1 | Burkholderia pyrrocinia |
26 | 1061224 | 1061466 | - | NZ_LN907827.1 | Erwinia gerundensis |
27 | 2264979 | 2265245 | - | NZ_CP054626.1 | Cupriavidus gilardii |
28 | 755726 | 755992 | - | NZ_CP010554.1 | Rugosibacter aromaticivorans |
29 | 2677703 | 2677987 | - | NZ_CP026112.1 | Paraburkholderia terrae |
30 | 1158314 | 1158598 | - | NZ_CP015959.1 | Paraburkholderia caribensis |
31 | 2025565 | 2025795 | + | NZ_CP016172.1 | Bordetella flabilis |
32 | 1403643 | 1403873 | + | NZ_CP040709.1 | Inhella inkyongensis |
33 | 3529276 | 3529515 | - | NZ_CP053073.1 | Usitatibacter palustris |
34 | 2230542 | 2230790 | - | NC_022357.1 | Sulfuricella denitrificans skB26 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02649.16 | 0.82 | 28 | 2898.5 | same-strand | Type I GTP cyclohydrolase folE2 |
2 | PF13292.8 | 1.0 | 34 | 923.0 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
3 | PF02779.26 | 1.0 | 34 | 923.0 | same-strand | Transketolase, pyrimidine binding domain |
4 | PF02780.22 | 1.0 | 34 | 923.0 | same-strand | Transketolase, C-terminal domain |
5 | PF00348.19 | 1.0 | 34 | -3 | same-strand | Polyprenyl synthetase |
6 | PF00848.21 | 0.76 | 26 | 221.0 | opposite-strand | Ring hydroxylating alpha subunit (catalytic domain) |
7 | PF00355.28 | 0.71 | 24 | 245.5 | opposite-strand | Rieske [2Fe-2S] domain |