Result : EXP03151
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03151 |
| NCBI Accession ID | |
| Organism | Bacteroides,Parabacteroides,Prevotella |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGAAAACAAGCACAATATTTTACAAGAAGCGTGCCACTATCCTGGCATGTGCCACACTAGCTATTCCGAGATTTACTACTGAAAGTATAGCACAGACCACTAACTTTATATCACCATAA |
| Sequence | MKTSTIFYKKRATILACATLAIPRFTTESIAQTTNFISP |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 39 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 650420 | 650539 | + | NC_009614.1 | Phocaeicola vulgatus ATCC 8482 |
| 2 | 698864 | 698983 | + | NZ_LR699004.1 | Phocaeicola dorei |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_009614.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08541.12 | 1.0 | 2 | 7415.5 | opposite-strand | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal |
| 2 | PF08545.12 | 1.0 | 2 | 7415.5 | opposite-strand | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III |
| 3 | PF01783.25 | 1.0 | 2 | 7128.5 | opposite-strand | Ribosomal L32p protein family |
| 4 | PF02620.19 | 1.0 | 2 | 6579.0 | opposite-strand | Large ribosomal RNA subunit accumulation protein YceD |
| 5 | PF13601.8 | 1.0 | 2 | 892.0 | same-strand | Winged helix DNA-binding domain |
| 6 | PF12840.9 | 1.0 | 2 | 892.0 | same-strand | Helix-turn-helix domain |
| 7 | PF00056.25 | 1.0 | 2 | 1426.0 | same-strand | lactate/malate dehydrogenase, NAD binding domain |
| 8 | PF02866.20 | 1.0 | 2 | 1426.0 | same-strand | lactate/malate dehydrogenase, alpha/beta C-terminal domain |
| 9 | PF01807.22 | 1.0 | 2 | 2505.0 | same-strand | CHC2 zinc finger |
| 10 | PF08275.13 | 1.0 | 2 | 2505.0 | same-strand | DNA primase catalytic core, N-terminal domain |
| 11 | PF13155.8 | 1.0 | 2 | 2505.0 | same-strand | Toprim-like |
| 12 | PF13662.8 | 1.0 | 2 | 2505.0 | same-strand | Toprim domain |
++ More..