Result : EXP03135
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03135 |
| NCBI Accession ID | |
| Organism | Clostridium |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGAAAAAATGGAGATGTAAAGTTTGTGGTTATGAAGTAATAGCAGATGAGCCACCAGCAGTTTGCCCAGTATGTGGTGTACCAGCAGAAGAATTTGAAGAAATACCAATGGATGAATAA |
| Sequence | MKKWRCKVCGYEVIADEPPAVCPVCGVPAEEFEEIPMDE |
| Source of smORF | Metagenomic Ribo-seq |
| Function | The ORF matches to the profile of cl00202. Profile Description: N/A. Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer. |
| Pubmed ID | 32601270 |
| Domain | CDD:412217 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 39 |
++ More..
| Conservation Analysis |
No. of Species: 30
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1582384 | 1582491 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 2 | 4861527 | 4861664 | + | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 3 | 2005561 | 2005659 | - | NC_009464.1 | Methanocella arvoryzae MRE50 |
| 4 | 555383 | 555493 | - | NC_015578.1 | Treponema primitia ZAS-2 |
| 5 | 697868 | 697969 | - | NC_012108.1 | Desulfobacterium autotrophicum HRM2 |
| 6 | 3612080 | 3612190 | + | NC_002939.5 | Geobacter sulfurreducens PCA |
| 7 | 3012671 | 3012775 | + | NZ_CP009520.1 | Methanosarcina vacuolata Z-761 |
| 8 | 752079 | 752183 | - | NZ_CP009530.1 | Methanosarcina barkeri 227 |
| 9 | 3647255 | 3647365 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
| 10 | 2875926 | 2876036 | + | NC_013665.1 | Methanocella paludicola SANAE |
| 11 | 1782060 | 1782170 | - | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 12 | 2196488 | 2196592 | + | NZ_CP017768.1 | Methanobacterium subterraneum |
| 13 | 3272872 | 3272985 | + | NZ_CP009788.1 | Geobacter pickeringii |
| 14 | 986376 | 986480 | - | NC_008553.1 | Methanothrix thermoacetophila PT |
| 15 | 1070990 | 1071094 | + | NZ_AP019779.1 | Methanobrevibacter arboriphilus |
| 16 | 493257 | 493364 | - | NZ_AP019779.1 | Methanobrevibacter arboriphilus |
| 17 | 808734 | 808859 | - | NC_009712.1 | Methanoregula boonei 6A8 |
| 18 | 194032 | 194136 | + | NZ_LN734822.1 | Methanobacterium formicicum |
| 19 | 3973968 | 3974072 | - | NC_003901.1 | Methanosarcina mazei Go1 |
| 20 | 2371977 | 2372087 | - | NC_015520.1 | Mahella australiensis 50-1 BON |
| 21 | 2672194 | 2672304 | - | NZ_CP017253.2 | Clostridium taeniosporum |
| 22 | 197428 | 197538 | + | NC_015574.1 | Methanobacterium paludis |
| 23 | 111583 | 111714 | + | NZ_CP048649.1 | Aminipila butyrica |
| 24 | 357517 | 357633 | + | NZ_CP018258.1 | Dehalogenimonas formicexedens |
| 25 | 132633 | 132749 | + | NZ_AP019309.1 | Intestinibaculum porci |
| 26 | 1419388 | 1419507 | - | NC_022567.1 | Adlercreutzia equolifaciens DSM 19450 |
| 27 | 1427986 | 1428123 | - | NC_013203.1 | Lancefieldella parvulum DSM 20469 |
| 28 | 1170484 | 1170594 | - | NC_015318.1 | Hippea maritima DSM 10411 |
| 29 | 1354942 | 1355058 | + | NC_013204.1 | Eggerthella lenta DSM 2243 |
| 30 | 522448 | 522585 | + | NZ_LT996885.1 | Dialister massiliensis |
| 31 | 327354 | 327452 | + | NC_017034.1 | Methanocella conradii HZ254 |
++ More..