Result : EXP03133
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03133 |
| NCBI Accession ID | |
| Organism | Methanobrevibacter |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGCTTATGTATGTAAAGTATGTGGATATGTTTACGAAGGCGACGATTTTGAAGACTTACCTGATGACTGGGTATGTCCTCTTTGTGGTGTGGGAAAAGACCAATTTGAAGAACAATAA |
| Sequence | MAYVCKVCGYVYEGDDFEDLPDDWVCPLCGVGKDQFEEQ |
| Source of smORF | Metagenomic Ribo-seq |
| Function | The ORF matches to the profile of cl00202. Profile Description: N/A. Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer. |
| Pubmed ID | 32601270 |
| Domain | CDD:412217 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 39 |
++ More..
| Conservation Analysis |
No. of Species: 62
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 184998 | 185117 | - | NC_009515.1 | Methanobrevibacter smithii ATCC 35061 |
| 2 | 1621808 | 1621948 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 3 | 548442 | 548582 | + | NC_014408.1 | Methanothermobacter marburgensis str. Marburg |
| 4 | 103568 | 103708 | + | NC_000916.1 | Methanothermobacter thermautotrophicus str. Delta H |
| 5 | 1066459 | 1066584 | + | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 6 | 90790 | 90930 | + | NZ_AP019779.1 | Methanobrevibacter arboriphilus |
| 7 | 766241 | 766357 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 8 | 132633 | 132749 | + | NZ_AP019309.1 | Intestinibaculum porci |
| 9 | 1182410 | 1182550 | - | NZ_LT607756.1 | Methanobacterium congolense |
| 10 | 2452320 | 2452460 | - | NC_011899.1 | Halothermothrix orenii H 168 |
| 11 | 1263370 | 1263510 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 12 | 2367358 | 2367486 | - | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 13 | 3029535 | 3029663 | - | NC_014393.1 | Clostridium cellulovorans 743B |
| 14 | 111583 | 111714 | + | NZ_CP048649.1 | Aminipila butyrica |
| 15 | 256493 | 256612 | + | NZ_CP048649.1 | Aminipila butyrica |
| 16 | 44941 | 45066 | - | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
| 17 | 964322 | 964426 | + | NZ_LT906477.1 | Clostridium cochlearium |
| 18 | 1364864 | 1364998 | - | NZ_LR778174.1 | Veillonella parvula |
| 19 | 1306790 | 1306924 | - | NZ_LR134375.1 | Veillonella dispar |
| 20 | 1253046 | 1253180 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 21 | 796796 | 796930 | + | NZ_LT906470.1 | Veillonella rodentium |
| 22 | 2646766 | 2646891 | + | NZ_AP018449.1 | Methylomusa anaerophila |
| 23 | 2754801 | 2754938 | - | NC_015578.1 | Treponema primitia ZAS-2 |
| 24 | 1078802 | 1078927 | - | NC_002967.9 | Treponema denticola ATCC 35405 |
| 25 | 1721583 | 1721708 | + | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 26 | 76500 | 76625 | + | NZ_CP009228.1 | Treponema putidum |
| 27 | 180980 | 181120 | - | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 28 | 872403 | 872543 | - | NC_017096.1 | Caldisericum exile AZM16c01 |
| 29 | 1170484 | 1170594 | - | NC_015318.1 | Hippea maritima DSM 10411 |
| 30 | 3219823 | 3219924 | - | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
| 31 | 1713101 | 1713229 | + | NC_013849.1 | Ferroglobus placidus DSM 10642 |
| 32 | 1093464 | 1093601 | - | NC_020913.1 | Candidatus Methanomethylophilus alvus Mx1201 |
| 33 | 2616081 | 2616179 | + | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 34 | 352429 | 352554 | - | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 35 | 700026 | 700163 | + | NZ_CP026606.1 | Methanococcus maripaludis |
| 36 | 2019493 | 2019624 | - | NC_021169.1 | Archaeoglobus sulfaticallidus PM70-1 |
| 37 | 118039 | 118164 | + | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 38 | 2704345 | 2704482 | + | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 39 | 1417129 | 1417266 | - | NC_014654.1 | Halanaerobium hydrogeniformans |
| 40 | 2342052 | 2342189 | - | NZ_AP023213.1 | Citrifermentans bremense |
| 41 | 2213271 | 2213402 | + | NZ_CP029256.1 | Christensenella minuta |
| 42 | 1170719 | 1170844 | + | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 43 | 1715499 | 1715639 | - | NZ_CP021023.1 | Sedimentisphaera salicampi |
| 44 | 3647255 | 3647365 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
| 45 | 2805524 | 2805652 | - | NC_015577.1 | Treponema azotonutricium ZAS-9 |
| 46 | 642737 | 642871 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 47 | 1131906 | 1132043 | + | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 48 | 1442318 | 1442446 | + | NZ_CP011267.1 | Geoglobus ahangari |
| 49 | 635372 | 635509 | - | NZ_CP034413.2 | Dysosmobacter welbionis |
| 50 | 1636918 | 1637043 | - | NZ_CP009302.1 | Berryella intestinalis |
| 51 | 3472668 | 3472808 | - | NZ_CP036259.1 | Sporomusa termitida |
| 52 | 2489883 | 2490023 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 53 | 1339711 | 1339848 | - | NC_009634.1 | Methanococcus vannielii SB |
| 54 | 522287 | 522424 | - | NZ_AP023049.1 | Alistipes indistinctus |
| 55 | 1658390 | 1658521 | - | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 56 | 1782060 | 1782170 | - | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 57 | 775681 | 775821 | + | NC_015389.1 | Coriobacterium glomerans PW2 |
| 58 | 3612080 | 3612190 | + | NC_002939.5 | Geobacter sulfurreducens PCA |
| 59 | 4641842 | 4641976 | - | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 60 | 1427986 | 1428123 | - | NC_013203.1 | Lancefieldella parvulum DSM 20469 |
| 61 | 3272872 | 3272985 | + | NZ_CP009788.1 | Geobacter pickeringii |
| 62 | 1757429 | 1757569 | - | NZ_LT635455.1 | Olsenella timonensis |
| 63 | 2652914 | 2653030 | - | NZ_CP032683.1 | Methanosarcina flavescens |
++ More..