Result : EXP03122
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03122 |
| NCBI Accession ID | |
| Organism | |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGTGCCCACGTGCTGCGCTATGGTCCCGCATGGCAATTGGCACATGGGCAAATTCGCACATTATTCAACTGAGCAACAGCATGATATTCAATGCGGAGACAATCACCGCAATGGNATAA |
| Sequence | MCPRAALWSRMAIGTWANSHIIQLSNSMIFNAETITAMX |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 39 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3864208 | 3864327 | - | NZ_LR699004.1 | Phocaeicola dorei |
| 2 | 3499352 | 3499471 | - | NC_009614.1 | Phocaeicola vulgatus ATCC 8482 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR699004.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01566.20 | 1.0 | 2 | -54.0 | opposite-strand | Natural resistance-associated macrophage protein |
| 2 | PF00999.23 | 1.0 | 2 | 12.0 | same-strand | Sodium/hydrogen exchanger family |
| 3 | PF01554.20 | 1.0 | 2 | 1457.0 | same-strand | MatE |
| 4 | PF14667.8 | 1.0 | 2 | 1457.0 | same-strand | Polysaccharide biosynthesis C-terminal domain |
| 5 | PF13419.8 | 1.0 | 2 | 2899.0 | opposite-strand | Haloacid dehalogenase-like hydrolase |
| 6 | PF00702.28 | 1.0 | 2 | 2899.0 | opposite-strand | haloacid dehalogenase-like hydrolase |
| 7 | PF02548.17 | 1.0 | 2 | 3602.0 | opposite-strand | Ketopantoate hydroxymethyltransferase |
++ More..