Result : EXP03114
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03114 |
| NCBI Accession ID | |
| Organism | Streptococcus |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGATTCAAACAGAAACTCGTTTGAAAGTCGCTGACAACAGTGGCGCACGCGAAGCACTTCGTCTTGCTAGCCACAAATTGCCAGTTAAAACTAAATTTGTGAAACGTGAAGCAGAATAA |
| Sequence | MIQTETRLKVADNSGAREALRLASHKLPVKTKFVKREAE |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 39 |
++ More..
| Conservation Analysis |
No. of Species: 11
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2863441 | 2863548 | + | NZ_CP036402.1 | Egibacter rhizosphaerae |
| 2 | 3979461 | 3979574 | - | NZ_LR134355.1 | Mycolicibacterium chitae |
| 3 | 2422776 | 2422889 | - | NZ_AP022593.1 | Mycolicibacterium arabiense |
| 4 | 2506670 | 2506783 | + | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
| 5 | 1130337 | 1130450 | + | NZ_LR134356.1 | Mycolicibacterium aurum |
| 6 | 1273242 | 1273355 | - | NZ_AP022596.1 | Mycolicibacterium helvum |
| 7 | 1162666 | 1162779 | + | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
| 8 | 2205046 | 2205159 | - | NZ_AP022577.1 | Mycolicibacterium aubagnense |
| 9 | 2471624 | 2471737 | + | NZ_AP022588.1 | Mycolicibacterium sediminis |
| 10 | 4709191 | 4709304 | - | NZ_CP062008.1 | Mycolicibacterium mucogenicum DSM 44124 |
| 11 | 5037445 | 5037558 | + | NZ_AP022616.1 | Mycolicibacterium phocaicum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP036402.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00276.22 | 1.0 | 11 | 2821 | same-strand | Ribosomal protein L23 |
| 2 | PF03947.20 | 1.0 | 11 | 1946 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 3 | PF00181.25 | 1.0 | 11 | 1946 | same-strand | Ribosomal Proteins L2, RNA binding domain |
| 4 | PF00203.23 | 1.0 | 11 | 1652 | same-strand | Ribosomal protein S19 |
| 5 | PF00237.21 | 1.0 | 11 | 1142 | same-strand | Ribosomal protein L22p/L17e |
| 6 | PF00189.22 | 1.0 | 11 | 306 | same-strand | Ribosomal protein S3, C-terminal domain |
| 7 | PF07650.19 | 1.0 | 11 | 306 | same-strand | KH domain |
| 8 | PF00831.25 | 1.0 | 11 | 0 | same-strand | Ribosomal L29 protein |
| 9 | PF00366.22 | 1.0 | 11 | 233 | same-strand | Ribosomal protein S17 |
++ More..