Result : EXP03113
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03113 |
| NCBI Accession ID | |
| Organism | Faecalibacterium,Catenibacterium |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGCAGAAGTCTATGCAAACCTCATCCGCCGGAGGCGGAAAACCATCGAGCAGGTGCCGGCGCTGATTCGGAAGCAGGTTGAGGAAATCCTGAAGGACCTCGAAGTCGAGGTCGAGTGA |
| Sequence | MAEVYANLIRRRRKTIEQVPALIRKQVEEILKDLEVEVE |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 39 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2568812 | 2568931 | - | NZ_CP019870.1 | Clostridioides difficile |
| 2 | 7369390 | 7369497 | - | NZ_CP009285.1 | Paenibacillus borealis |
| 3 | 7336388 | 7336489 | - | NZ_CP009285.1 | Paenibacillus borealis |
| 4 | 5962522 | 5962650 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 5 | 3637 | 3762 | - | NC_012782.1 | [Eubacterium] eligens ATCC 27750 |
| 6 | 1406004 | 1406135 | - | NZ_CP029487.1 | Eubacterium maltosivorans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP019870.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF10076.11 | 0.6 | 3 | 4003 | same-strand | Uncharacterised protein conserved in bacteria (DUF2313) |
++ More..