Protein Information |
Information Type | Description |
---|---|
Protein name | Translational regulator CsrA |
NCBI Accession ID | CP001322.1 |
Organism | Desulfatibacillum aliphaticivorans |
Left | 1316458 |
Right | 1316706 |
Strand | - |
Nucleotide Sequence | ATGCTCGTTCTGACAAGGAAGTCCGGCCAAAGAATAAGTATTGGAGACGACATAGTTTTACATGTTCTCGAAATCAAGGGAACCCAGGTGCGCATAGGCGTTGACGCCCCCAGAGGCGTGGGCGTGCACCGCTTTGAGGTGTACCAGCGCATTCAGGCGGAAAATCAGTCCGCCGCCTCCATGGATCAGGATGTTCTGTCAGGTGCGGCGGGACTTTTTGAGCAACTGAATCTCAAGAAAACCAAGTGA |
Sequence | MLVLTRKSGQRISIGDDIVLHVLEIKGTQVRIGVDAPRGVGVHRFEVYQRIQAENQSAASMDQDVLSGAAGLFEQLNLKKTK |
Source of smORF | Swiss-Prot |
Function | A translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Usually binds in the 5'-UTR at or near the Shine-Dalgarno sequence preventing ribosome-binding, thus repressing translation. Its main target seems to be the major flagellin gene, while its function is anatagonized by FliW. {ECO:0000255|HAMAP-Rule:MF_00167}. |
Pubmed ID | 21651686 |
Domain | CDD:412510 |
Functional Category | RNA-binding |
Uniprot ID | B8FK13 |
ORF Length (Amino Acid) | 82 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1316458 | 1316706 | - | NC_011768.1 | Desulfatibacillum aliphaticivorans |
2 | 2872651 | 2872902 | - | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
3 | 2872915 | 2873145 | - | NZ_CP029797.1 | Paraliobacillus zengyii |
4 | 581138 | 581365 | + | NZ_CP026520.1 | Paenibacillus chitinolyticus |
5 | 3175744 | 3175962 | + | NZ_CP008876.1 | Terribacillus goriensis |
6 | 3052267 | 3052503 | + | NC_006138.1 | Desulfotalea psychrophila LSv54 |
7 | 4028009 | 4028233 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
8 | 3341676 | 3341879 | - | NZ_CP021435.1 | Halomonas beimenensis |
9 | 439987 | 440214 | + | NZ_CP012024.1 | Bacillus smithii |
10 | 926283 | 926525 | + | NC_017098.1 | Spirochaeta africana DSM 8902 |
11 | 3195566 | 3195790 | - | NZ_CP011150.1 | Bacillus altitudinis |
12 | 3862801 | 3863034 | - | NC_008576.1 | Magnetococcus marinus MC-1 |
13 | 691099 | 691338 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
14 | 1276360 | 1276578 | + | NC_013851.1 | Allochromatium vinosum DSM 180 |
15 | 7623788 | 7624021 | + | NZ_CP036276.1 | Symmachiella dynata |
16 | 2370805 | 2371041 | - | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
17 | 585907 | 586149 | + | NZ_CP012502.1 | Bacillus beveridgei |
18 | 3881618 | 3881845 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
19 | 1803837 | 1804052 | - | NC_008789.1 | Halorhodospira halophila SL1 |
20 | 1309609 | 1309839 | + | NC_023035.1 | Salinispira pacifica |
21 | 614490 | 614729 | + | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
22 | 2008259 | 2008504 | - | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
23 | 2512853 | 2513071 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
24 | 1418562 | 1418762 | + | NZ_CP041242.1 | Lysobacter alkalisoli |
25 | 5596706 | 5596948 | - | NC_013739.1 | Conexibacter woesei DSM 14684 |
26 | 3178197 | 3178436 | - | NZ_CP010311.1 | Geoalkalibacter subterraneus |
27 | 348433 | 348657 | + | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02623.17 | 0.74 | 20 | 0.5 | same-strand | FliW protein |
2 | PF00669.22 | 0.78 | 21 | 1058 | same-strand | Bacterial flagellin N-terminal helical region |
3 | PF00700.23 | 0.74 | 20 | 996.5 | same-strand | Bacterial flagellin C-terminal helical region |
4 | PF05130.14 | 0.67 | 18 | 3607 | same-strand | FlgN protein |