Result : B8F6W0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0235 protein HAPS_1504 |
| NCBI Accession ID | CP001321.1 |
| Organism | Haemophilus parasuis serovar 5 (strain SH0165) (Glaesserella parasuis) |
| Left | 1481954 |
| Right | 1482247 |
| Strand | + |
| Nucleotide Sequence | ATGCAAGCGGTCGAATTTTGTGAAAATCCGCAAGGTATCCGCTTGCGGATTTTTTTACAACCGAAAGCAAGTCGAGATCAGATTGTCGGTTTACACGATAACGAACTCAAAATTGCTATTACCGCTCCACCTATCGATGGGCAGGCAAATGCTCACTTGCTGAAATATCTAAGTAAGTTATTTAAAGTCCCCAAAAGCAGTATTGTGTTGGAAAAGGGCGAATTACAACGCCATAAGCAAATTTTTGTGCCTGAACCGAAGCTCATTCCAAAAGAGATTGAAGTATTAGGCTGA |
| Sequence | MQAVEFCENPQGIRLRIFLQPKASRDQIVGLHDNELKIAITAPPIDGQANAHLLKYLSKLFKVPKSSIVLEKGELQRHKQIFVPEPKLIPKEIEVLG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00811. Profile Description: Uncharacterized ACR, YggU family COG1872. hypothetical protein; Validated |
| Pubmed ID | 19074396 |
| Domain | CDD:412584 |
| Functional Category | Others |
| Uniprot ID | B8F6W0 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 202
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1481954 | 1482247 | + | NC_011852.1 | Glaesserella parasuis SH0165 |
| 2 | 792229 | 792531 | + | NZ_CP015029.1 | Frederiksenia canicola |
| 3 | 1808521 | 1808820 | - | NZ_CP016604.1 | Otariodibacter oris |
| 4 | 2297473 | 2297772 | - | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
| 5 | 2343821 | 2344120 | - | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
| 6 | 466687 | 466980 | - | NZ_CP015425.1 | [Haemophilus] ducreyi |
| 7 | 1616882 | 1617175 | - | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
| 8 | 351487 | 351789 | + | NZ_CP006954.1 | Bibersteinia trehalosi USDA-ARS-USMARC-188 |
| 9 | 878793 | 879050 | - | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
| 10 | 296228 | 296518 | - | NZ_LR134167.1 | Avibacterium volantium |
| 11 | 2172533 | 2172820 | + | NZ_CP015031.1 | Basfia succiniciproducens |
| 12 | 299623 | 299910 | + | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
| 13 | 1914455 | 1914742 | - | NZ_CP040863.1 | Rodentibacter heylii |
| 14 | 864753 | 865040 | - | NZ_LS483458.1 | Haemophilus haemolyticus |
| 15 | 769173 | 769427 | + | NZ_CP028926.1 | Pasteurella multocida |
| 16 | 341148 | 341393 | - | NZ_CP016605.1 | Bisgaardia hudsonensis |
| 17 | 1699093 | 1699395 | + | NZ_LT906448.1 | Pasteurella dagmatis |
| 18 | 715477 | 715770 | + | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
| 19 | 1021334 | 1021621 | - | NZ_LT906463.1 | Haemophilus pittmaniae |
| 20 | 3890092 | 3890382 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 21 | 2146442 | 2146741 | - | NZ_CP018804.1 | Histophilus somni |
| 22 | 4076845 | 4077135 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 23 | 4382961 | 4383251 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 24 | 1118008 | 1118301 | - | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 25 | 807643 | 807933 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 26 | 2596930 | 2597220 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 27 | 4251004 | 4251300 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 28 | 3992467 | 3992754 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 29 | 3923834 | 3924124 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 30 | 4466693 | 4466989 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 31 | 3894956 | 3895252 | + | NC_015968.1 | Enterobacter soli |
| 32 | 3920880 | 3921176 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 33 | 4476040 | 4476336 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 34 | 795489 | 795779 | - | NZ_CP050508.1 | Raoultella terrigena |
| 35 | 1644996 | 1645292 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 36 | 749107 | 749397 | - | NZ_CP041247.1 | Raoultella electrica |
| 37 | 894232 | 894522 | + | NZ_CP026047.1 | Raoultella planticola |
| 38 | 800648 | 800938 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 39 | 830740 | 831036 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 40 | 727978 | 728265 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 41 | 3373571 | 3373867 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 42 | 828987 | 829277 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 43 | 910534 | 910824 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 44 | 3790911 | 3791201 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 45 | 941488 | 941775 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 46 | 458038 | 458331 | - | NZ_CP071325.1 | Photobacterium ganghwense |
| 47 | 530846 | 531115 | - | NZ_LS483470.1 | Leminorella richardii |
| 48 | 1354807 | 1355097 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 49 | 3893434 | 3893730 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 50 | 1080679 | 1080969 | + | NZ_CP053416.1 | Salmonella bongori |
| 51 | 3262237 | 3262527 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 52 | 819035 | 819325 | - | NZ_CP042220.2 | Dickeya poaceiphila |
| 53 | 3849684 | 3849980 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 54 | 4491393 | 4491683 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 55 | 764699 | 764989 | - | NZ_CP054254.1 | Klebsiella variicola |
| 56 | 577065 | 577322 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 57 | 793674 | 793964 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 58 | 219742 | 220014 | + | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 59 | 2166887 | 2167177 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 60 | 743907 | 744197 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 61 | 3583162 | 3583416 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 62 | 4139394 | 4139651 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 63 | 3507402 | 3507659 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 64 | 735535 | 735816 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 65 | 770974 | 771264 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 66 | 3772421 | 3772693 | + | NZ_CP032487.1 | Yersinia hibernica |
| 67 | 4203758 | 4204048 | - | NZ_CP038469.1 | Citrobacter tructae |
| 68 | 24104 | 24394 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 69 | 3706161 | 3706415 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 70 | 568133 | 568399 | - | NZ_LR134201.1 | Cedecea lapagei |
| 71 | 25429 | 25707 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 72 | 3235744 | 3236034 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 73 | 1869278 | 1869568 | + | NZ_CP033744.1 | Citrobacter freundii |
| 74 | 812366 | 812638 | - | NZ_CP011118.1 | Yersinia enterocolitica |
| 75 | 1870938 | 1871195 | + | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 76 | 3639596 | 3639886 | + | NZ_LT615367.1 | Dickeya aquatica |
| 77 | 3034677 | 3034967 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 78 | 3096383 | 3096673 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 79 | 429543 | 429803 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 80 | 3838016 | 3838306 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 81 | 5284384 | 5284674 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 82 | 714830 | 715120 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 83 | 3785845 | 3786117 | + | NZ_CP043727.1 | Yersinia canariae |
| 84 | 584974 | 585273 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 85 | 657390 | 657692 | - | NZ_LR134531.1 | Pragia fontium |
| 86 | 712244 | 712540 | - | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 87 | 3540814 | 3541101 | + | NZ_CP046378.1 | Shewanella algae |
| 88 | 1148407 | 1148664 | + | NZ_CP015137.1 | Dickeya solani IPO 2222 |
| 89 | 2017513 | 2017785 | + | NZ_CP009787.1 | Yersinia rohdei |
| 90 | 3976331 | 3976588 | + | NZ_CP031560.1 | Dickeya dianthicola |
| 91 | 684655 | 684951 | - | NZ_CP029185.2 | Limnobaculum parvum |
| 92 | 3037467 | 3037757 | + | NZ_AP014857.1 | Escherichia albertii |
| 93 | 1985344 | 1985634 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 94 | 4010712 | 4011002 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 95 | 915017 | 915307 | - | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 96 | 3580009 | 3580299 | + | NZ_LR134340.1 | Escherichia marmotae |
| 97 | 4958210 | 4958500 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 98 | 1933825 | 1934097 | - | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 99 | 733620 | 733874 | - | NZ_CP046293.1 | Yersinia intermedia |
| 100 | 365888 | 366178 | - | NZ_AP014524.1 | Vibrio cholerae MS6 |
| 101 | 4471676 | 4471948 | + | NZ_CP048784.1 | Serratia liquefaciens |
| 102 | 680353 | 680643 | - | NZ_AP018685.1 | Vibrio rumoiensis |
| 103 | 3496028 | 3496318 | - | NZ_CP014136.1 | Gibbsiella quercinecans |
| 104 | 551041 | 551304 | - | NZ_CP023525.1 | Cedecea neteri |
| 105 | 432825 | 433115 | + | NZ_CP007230.1 | Yersinia similis |
| 106 | 3782862 | 3783119 | - | NZ_CP009460.1 | Dickeya fangzhongdai |
| 107 | 1422834 | 1423106 | - | NC_010334.1 | Shewanella halifaxensis HAW-EB4 |
| 108 | 3890160 | 3890432 | + | NC_011566.1 | Shewanella piezotolerans WP3 |
| 109 | 3705756 | 3706025 | + | NC_016901.1 | Shewanella baltica OS678 |
| 110 | 3940779 | 3941036 | + | NC_014500.1 | Dickeya dadantii 3937 |
| 111 | 872135 | 872425 | - | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
| 112 | 3369917 | 3370165 | + | NZ_CP022358.1 | Shewanella bicestrii |
| 113 | 3794351 | 3794608 | + | NZ_CP038498.1 | Pectobacterium punjabense |
| 114 | 3164547 | 3164843 | + | NZ_CP046268.1 | Vibrio spartinae |
| 115 | 3044210 | 3044467 | + | NZ_CP034035.1 | Brenneria rubrifaciens |
| 116 | 3784030 | 3784320 | + | NZ_CP025799.1 | Dickeya zeae |
| 117 | 713231 | 713488 | + | NZ_CP011254.1 | Serratia fonticola |
| 118 | 443034 | 443294 | - | NZ_AP014635.1 | Vibrio tritonius |
| 119 | 4421238 | 4421513 | + | NZ_CP038662.1 | Serratia nematodiphila |
| 120 | 4535361 | 4535633 | + | NC_015567.1 | Serratia plymuthica AS9 |
| 121 | 2537915 | 2538172 | - | NZ_CP047495.1 | Pectobacterium brasiliense |
| 122 | 3986590 | 3986847 | + | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 123 | 859797 | 860054 | - | NZ_CP051652.1 | Pectobacterium carotovorum |
| 124 | 137736 | 137993 | - | NZ_CP015749.1 | Pectobacterium parmentieri |
| 125 | 2793178 | 2793435 | + | NZ_CP017482.1 | Pectobacterium polaris |
| 126 | 4472699 | 4472971 | + | NZ_LR134494.1 | Serratia quinivorans |
| 127 | 432622 | 432894 | + | NZ_CP023009.1 | Lonsdalea britannica |
| 128 | 1362771 | 1363043 | - | NC_009901.1 | Shewanella pealeana ATCC 700345 |
| 129 | 591881 | 592153 | - | NZ_CP065534.1 | Lonsdalea populi |
| 130 | 1463777 | 1464064 | - | NC_009831.1 | Shewanella sediminis HAW-EB3 |
| 131 | 1001022 | 1001279 | + | NZ_CP065044.1 | Pectobacterium aroidearum |
| 132 | 4019380 | 4019637 | + | NZ_CP034938.1 | Pectobacterium odoriferum |
| 133 | 692754 | 693011 | + | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 134 | 1576004 | 1576276 | + | NZ_CP011078.1 | Yersinia ruckeri |
| 135 | 47112 | 47402 | - | NZ_CP014137.1 | Brenneria goodwinii |
| 136 | 484150 | 484452 | + | NZ_CP050150.1 | Hafnia alvei |
| 137 | 743581 | 743871 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 138 | 699649 | 699921 | - | NZ_CP071320.1 | Serratia ureilytica |
| 139 | 119322 | 119615 | - | NZ_CP035688.1 | Vibrio metoecus |
| 140 | 1893606 | 1893896 | - | NZ_CP065150.1 | Vibrio kanaloae |
| 141 | 877645 | 877902 | - | NZ_CP034036.1 | Brenneria nigrifluens DSM 30175 = ATCC 13028 |
| 142 | 476540 | 476857 | + | NZ_LR134510.1 | Actinobacillus delphinicola |
| 143 | 413236 | 413508 | - | NZ_CP047475.1 | Vibrio astriarenae |
| 144 | 4404158 | 4404430 | + | NZ_LT906479.1 | Serratia ficaria |
| 145 | 624334 | 624624 | + | NZ_CP065640.1 | Serratia rubidaea |
| 146 | 1213795 | 1214082 | - | NC_014012.1 | Shewanella violacea DSS12 |
| 147 | 1366730 | 1367023 | + | NZ_CP046793.1 | Vibrio metschnikovii |
| 148 | 2873667 | 2873957 | + | NC_011753.2 | Vibrio atlanticus |
| 149 | 30986 | 31240 | - | NZ_LT960611.1 | Vibrio tapetis subsp. tapetis |
| 150 | 2627815 | 2628069 | + | NZ_CP016414.1 | Vibrio scophthalmi |
| 151 | 2624695 | 2624949 | + | NZ_AP019651.1 | Vibrio taketomensis |
| 152 | 3706868 | 3707140 | + | NZ_CP016948.1 | Serratia surfactantfaciens |
| 153 | 2609641 | 2609898 | + | NZ_CP067057.1 | Rahnella aceris |
| 154 | 3420395 | 3420685 | + | NZ_CP016043.1 | Edwardsiella hoshinae |
| 155 | 419874 | 420164 | - | NZ_CP039700.1 | Vibrio cyclitrophicus |
| 156 | 1951565 | 1951861 | + | NZ_AP018689.1 | Vibrio aphrogenes |
| 157 | 3812752 | 3813051 | + | NZ_CP034015.1 | Shewanella livingstonensis |
| 158 | 341352 | 341642 | - | NZ_CP009354.1 | Vibrio tubiashii ATCC 19109 |
| 159 | 806339 | 806596 | - | NZ_CP005974.1 | Photobacterium gaetbulicola Gung47 |
| 160 | 350106 | 350357 | - | NZ_CP051180.1 | Ferrimonas lipolytica |
| 161 | 1237599 | 1237898 | - | NZ_CP041036.1 | Shewanella polaris |
| 162 | 2049435 | 2049725 | - | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 163 | 288602 | 288901 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 164 | 163277 | 163567 | - | NZ_CP009977.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 165 | 1309733 | 1310023 | - | NC_009092.1 | Shewanella loihica PV-4 |
| 166 | 35804 | 36058 | - | NZ_AP019657.1 | Vibrio ponticus |
| 167 | 2896519 | 2896773 | + | NZ_CP044069.1 | Vibrio vulnificus |
| 168 | 3300192 | 3300446 | + | NZ_CP009467.1 | Vibrio harveyi |
| 169 | 303746 | 304000 | - | NZ_CP018312.1 | Vibrio rotiferianus |
| 170 | 2339292 | 2339546 | - | NZ_CP019959.1 | Vibrio owensii |
| 171 | 1682556 | 1682843 | - | NC_010506.1 | Shewanella woodyi ATCC 51908 |
| 172 | 935366 | 935656 | - | NC_013456.1 | Vibrio antiquarius |
| 173 | 2741132 | 2741386 | + | NZ_CP030788.1 | Vibrio campbellii |
| 174 | 3089974 | 3090264 | + | NZ_CP022272.1 | Shewanella marisflavi |
| 175 | 509716 | 510006 | - | NZ_CP031781.1 | Vibrio parahaemolyticus |
| 176 | 595924 | 596172 | + | NZ_LR134376.1 | Aeromonas encheleia |
| 177 | 4158473 | 4158736 | + | NZ_CP051883.1 | Aeromonas salmonicida |
| 178 | 896534 | 896824 | - | NZ_CP040990.1 | Vibrio furnissii |
| 179 | 484266 | 484556 | - | NZ_CP032093.1 | Vibrio alfacsensis |
| 180 | 359215 | 359505 | - | NZ_CP022741.1 | Vibrio qinghaiensis |
| 181 | 2352352 | 2352642 | + | NZ_CP014035.2 | Vibrio fluvialis |
| 182 | 2761334 | 2761624 | - | NZ_CP025792.1 | Vibrio jasicida 090810c |
| 183 | 3815184 | 3815441 | - | NZ_CP044060.1 | Aeromonas veronii |
| 184 | 4125603 | 4125866 | - | NZ_CP050851.1 | Aeromonas hydrophila |
| 185 | 1045036 | 1045326 | - | NC_012691.1 | Tolumonas auensis DSM 9187 |
| 186 | 4064631 | 4064888 | - | NZ_CP065745.1 | Aeromonas allosaccharophila |
| 187 | 3446003 | 3446317 | + | NC_008345.1 | Shewanella frigidimarina NCIMB 400 |
| 188 | 2912629 | 2912919 | + | NZ_CP040449.1 | Aeromonas simiae |
| 189 | 4171577 | 4171849 | - | NZ_AP022188.1 | Aeromonas media |
| 190 | 763128 | 763433 | + | NZ_CP014056.2 | Grimontia hollisae |
| 191 | 818899 | 819162 | - | NZ_CP006569.1 | Sodalis praecaptivus |
| 192 | 4598361 | 4598618 | - | NZ_CP041783.1 | Shewanella donghaensis |
| 193 | 1557435 | 1557695 | - | NZ_CP020472.1 | Shewanella japonica |
| 194 | 2591104 | 2591391 | + | NZ_CP020373.1 | Shewanella khirikhana |
| 195 | 2942139 | 2942378 | + | NZ_CP069213.1 | Shewanella litorisediminis |
| 196 | 2982515 | 2982760 | + | NC_008700.1 | Shewanella amazonensis SB2B |
| 197 | 90742 | 91047 | - | NZ_CP031961.1 | Pseudoalteromonas tunicata |
| 198 | 487641 | 487937 | - | NZ_CP047698.1 | Pseudomonas knackmussii |
| 199 | 582232 | 582528 | - | NZ_CP014158.1 | Pseudomonas citronellolis |
| 200 | 1146757 | 1147020 | + | NZ_CP021377.1 | Oceanisphaera profunda |
| 201 | 476016 | 476318 | - | NZ_CP012621.1 | Zobellella denitrificans |
| 202 | 272159 | 272452 | - | NZ_AP014545.1 | Amphritea japonica ATCC BAA-1530 |
| 203 | 29310 | 29603 | + | NZ_AP018724.1 | Sulfurivermis fontis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP045300.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02325.19 | 1.0 | 201 | 6.0 | same-strand | YGGT family |
| 2 | PF04055.23 | 0.83 | 168 | 618 | same-strand | Radical SAM superfamily |
| 3 | PF06969.18 | 0.83 | 168 | 618 | same-strand | HemN C-terminal domain |
| 4 | PF01725.18 | 0.84 | 169 | 32.0 | same-strand | Ham1 family |
| 5 | PF01168.22 | 0.89 | 180 | 1482 | same-strand | Alanine racemase, N-terminal domain |
| 6 | PF00437.22 | 0.65 | 131 | 2283 | opposite-strand | Type II/IV secretion system protein |
++ More..