Result : EXP03086
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03086 |
| NCBI Accession ID | |
| Organism | Alistipes |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGCTGATAATAAAGATGACGGAAAAAAATGGGTATGCACAGTTTGCGAATATGTGTATGACGGAGATATTCCTTTCGAAGAACTTCCTGATGATTGGGCTTGTCCGGTTTGCGGTGTCGGTAAGGAACTCTTTGTTTTGAAAGAAGTTTAA |
| Sequence | MADNKDDGKKWVCTVCEYVYDGDIPFEELPDDWACPVCGVGKELFVLKEV |
| Source of smORF | Metagenomic Ribo-seq |
| Function | The ORF matches to the profile of cl00202. Profile Description: N/A. Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer. |
| Pubmed ID | 32601270 |
| Domain | CDD:412217 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 50 |
++ More..
| Conservation Analysis |
No. of Species: 35
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4641842 | 4641976 | - | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 2 | 766190 | 766357 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 3 | 1182068 | 1182229 | - | NC_013522.1 | Thermanaerovibrio acidaminovorans DSM 6589 |
| 4 | 3631407 | 3631568 | - | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 5 | 398808 | 398966 | + | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 6 | 1315145 | 1315306 | - | NC_015574.1 | Methanobacterium paludis |
| 7 | 758250 | 758411 | + | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 8 | 1830644 | 1830805 | + | NC_016751.1 | Marinitoga piezophila KA3 |
| 9 | 3723199 | 3723363 | - | NZ_CP015401.2 | Bacteroides caecimuris |
| 10 | 60945 | 61112 | + | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 11 | 1208200 | 1208364 | + | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 12 | 1437879 | 1438043 | - | NZ_LT906459.1 | Odoribacter splanchnicus |
| 13 | 1954754 | 1954903 | - | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 14 | 2537459 | 2537620 | - | NZ_CP014223.1 | Anaerotignum propionicum DSM 1682 |
| 15 | 523665 | 523829 | - | NZ_CP045696.1 | Sodaliphilus pleomorphus |
| 16 | 709962 | 710123 | + | NZ_LT906446.1 | Megamonas hypermegale |
| 17 | 90790 | 90930 | + | NZ_AP019779.1 | Methanobrevibacter arboriphilus |
| 18 | 1854211 | 1854372 | + | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 19 | 1122886 | 1123047 | - | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 20 | 893163 | 893312 | + | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 21 | 1658390 | 1658521 | - | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 22 | 2099506 | 2099649 | + | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
| 23 | 752992 | 753156 | - | NZ_LR134506.1 | Porphyromonas cangingivalis |
| 24 | 1908275 | 1908439 | + | NC_009614.1 | Phocaeicola vulgatus ATCC 8482 |
| 25 | 1240563 | 1240727 | - | NZ_LR699004.1 | Phocaeicola dorei |
| 26 | 642716 | 642871 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 27 | 2912171 | 2912335 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 28 | 77688 | 77855 | + | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 29 | 1427986 | 1428123 | - | NC_013203.1 | Lancefieldella parvulum DSM 20469 |
| 30 | 1093464 | 1093601 | - | NC_020913.1 | Candidatus Methanomethylophilus alvus Mx1201 |
| 31 | 414136 | 414297 | + | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 32 | 1789039 | 1789185 | - | NC_010003.1 | Petrotoga mobilis SJ95 |
| 33 | 2460548 | 2460709 | - | NZ_CP045875.1 | Heliorestis convoluta |
| 34 | 564629 | 564787 | + | NZ_CP028106.1 | Fusobacterium gonidiaformans ATCC 25563 |
| 35 | 3185760 | 3185915 | - | NC_009253.1 | Desulfotomaculum reducens MI-1 |
++ More..