Result : B8E2U4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | CP001251.1 |
| Organism | Dictyoglomus turgidum (strain Z-1310 / DSM 6724) |
| Left | 1185018 |
| Right | 1185320 |
| Strand | + |
| Nucleotide Sequence | ATGGAAAAAAGAGATTTTAAAGAACAACTTAAGAAAACTGCTCATCTTGCAAGATTATATCTTACTCCTGAAGAGGAAGAGCTTTATGCTAAGCAATTACAGGATATTCTTGACTACTTTAAAAAATTACAGGAAGTGGATACTTCAAATATAGAACCTATGGCTCATGTATTGTCTCTTTCTAACATTTGGAGAGAGGACGAACCCAAAGGGAGTATATCTCAAGAAGAAGCCTTTAAAAATGCTCCTGAGATTGAGAATTTGGGATTTAAAATTCCAAGAATAATAAAGAGGGAAGAATGA |
| Sequence | MEKRDFKEQLKKTAHLARLYLTPEEEELYAKQLQDILDYFKKLQEVDTSNIEPMAHVLSLSNIWREDEPKGSISQEEAFKNAPEIENLGFKIPRIIKREE |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | 28066333 |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | B8E2U4 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1185018 | 1185320 | + | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 2 | 1017989 | 1018291 | + | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 3 | 551541 | 551798 | - | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 4 | 524696 | 524944 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 5 | 976741 | 976995 | + | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 6 | 2697531 | 2697788 | - | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 7 | 1329381 | 1329635 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011661.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01425.23 | 1.0 | 7 | 13 | same-strand | Amidase |
| 2 | PF02934.17 | 0.86 | 6 | 1482.5 | same-strand | GatB/GatE catalytic domain |
| 3 | PF02637.20 | 0.86 | 6 | 1482.5 | same-strand | GatB domain |
++ More..