Result : EXP03065
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03065 |
| NCBI Accession ID | |
| Organism | |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGATAATGATAATAGTACTCATTGTTAATCTCCCGCTTCAAAATGAAGTGTTGGAGGTTATAGGATGGGTTTTAATTTGGATATCTCTTGCATTAACAGTAATTTCAATGGTTGAATATGTATACAAGAATATCGAAGTACTTAAAAACTAA |
| Sequence | MIMIIVLIVNLPLQNEVLEVIGWVLIWISLALTVISMVEYVYKNIEVLKN |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 50 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 437452 | 437604 | + | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 2 | 2049607 | 2049759 | + | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 3 | 372351 | 372503 | - | NZ_LT990039.1 | Massilistercora timonensis |
| 4 | 1133311 | 1133469 | - | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 5 | 1233227 | 1233379 | - | NZ_LT635479.1 | Lachnoclostridium phocaeense |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LT990039.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05833.13 | 0.6 | 3 | 3733 | opposite-strand | NFACT N-terminal and middle domains |
| 2 | PF05670.15 | 0.6 | 3 | 3733 | opposite-strand | NFACT protein RNA binding domain |
| 3 | PF03755.15 | 0.8 | 4 | 2694.0 | same-strand | YicC-like family, N-terminal region |
| 4 | PF08340.13 | 0.8 | 4 | 2694.0 | same-strand | Domain of unknown function (DUF1732) |
| 5 | PF00625.23 | 1.0 | 5 | 2041 | same-strand | Guanylate kinase |
| 6 | PF13238.8 | 0.8 | 4 | 2036.0 | same-strand | AAA domain |
| 7 | PF01192.24 | 1.0 | 5 | 1784 | same-strand | RNA polymerase Rpb6 |
| 8 | PF00919.22 | 1.0 | 5 | 390 | same-strand | Uncharacterized protein family UPF0004 |
| 9 | PF04055.23 | 1.0 | 5 | 390 | same-strand | Radical SAM superfamily |
| 10 | PF18693.3 | 1.0 | 5 | 390 | same-strand | TRAM domain |
| 11 | PF02464.19 | 1.0 | 5 | 3 | same-strand | Competence-damaged protein |
| 12 | PF14057.8 | 0.6 | 3 | 5029 | same-strand | GGGtGRT protein |
| 13 | PF01938.22 | 0.8 | 4 | 389.5 | same-strand | TRAM domain |
++ More..