Protein Information |
Information Type | Description |
---|---|
Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
NCBI Accession ID | CP001251.1 |
Organism | Dictyoglomus turgidum (strain Z-1310 / DSM 6724) |
Left | 1460478 |
Right | 1460681 |
Strand | - |
Nucleotide Sequence | ATGAAGGAAGTAAATATTGATACACTTATTTCTAAAATACCTAACAAATATGTTTTGACTGTTGTAATATCAAAAAGAGCAAGGCAACTTTTTGAGGAGTTAAAGTTTTTGAAAACTATCGCGAGGGATCCTCTAATCCTTGCTATGGAAGAGATTGCTCAGGAGAAAATTGCTTATGGAGAAGGAGATGATTTAGAAGATTAG |
Sequence | MKEVNIDTLISKIPNKYVLTVVISKRARQLFEELKFLKTIARDPLILAMEEIAQEKIAYGEGDDLED |
Source of smORF | Swiss-Prot |
Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
Pubmed ID | 28066333 |
Domain | CDD:417484 |
Functional Category | Others |
Uniprot ID | B8E0X9 |
ORF Length (Amino Acid) | 67 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1460478 | 1460681 | - | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
2 | 1280225 | 1280428 | - | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01189.19 | 1.0 | 2 | 4240.5 | same-strand | 16S rRNA methyltransferase RsmB/F |
2 | PF01029.20 | 1.0 | 2 | 4240.5 | same-strand | NusB family |
3 | PF17125.7 | 1.0 | 2 | 4240.5 | same-strand | N-terminal domain of 16S rRNA methyltransferase RsmF |
4 | PF04298.14 | 1.0 | 2 | 3551.0 | same-strand | Putative neutral zinc metallopeptidase |
5 | PF00551.21 | 1.0 | 2 | 2588.0 | same-strand | Formyl transferase |
6 | PF02911.20 | 1.0 | 2 | 2588.0 | same-strand | Formyl transferase, C-terminal domain |
7 | PF01327.23 | 1.0 | 2 | 2130.0 | same-strand | Polypeptide deformylase |
8 | PF17764.3 | 1.0 | 2 | 7.5 | same-strand | 3'DNA-binding domain (3'BD) |
9 | PF18074.3 | 1.0 | 2 | 7.5 | same-strand | Primosomal protein N C-terminal domain |
10 | PF18319.3 | 1.0 | 2 | 7.5 | same-strand | PriA DNA helicase Cys-rich region (CRR) domain |
11 | PF00625.23 | 1.0 | 2 | -19.0 | same-strand | Guanylate kinase |
12 | PF04025.14 | 1.0 | 2 | 614.0 | same-strand | Domain of unknown function (DUF370) |
13 | PF08340.13 | 1.0 | 2 | 888.5 | same-strand | Domain of unknown function (DUF1732) |
14 | PF03755.15 | 1.0 | 2 | 888.5 | same-strand | YicC-like family, N-terminal region |
15 | PF00590.22 | 1.0 | 2 | 1810.5 | opposite-strand | Tetrapyrrole (Corrin/Porphyrin) Methylases |
16 | PF02504.17 | 1.0 | 2 | 2677.0 | opposite-strand | Fatty acid synthesis protein |