Result : B8E0X9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | CP001251.1 |
| Organism | Dictyoglomus turgidum (strain Z-1310 / DSM 6724) |
| Left | 1460478 |
| Right | 1460681 |
| Strand | - |
| Nucleotide Sequence | ATGAAGGAAGTAAATATTGATACACTTATTTCTAAAATACCTAACAAATATGTTTTGACTGTTGTAATATCAAAAAGAGCAAGGCAACTTTTTGAGGAGTTAAAGTTTTTGAAAACTATCGCGAGGGATCCTCTAATCCTTGCTATGGAAGAGATTGCTCAGGAGAAAATTGCTTATGGAGAAGGAGATGATTTAGAAGATTAG |
| Sequence | MKEVNIDTLISKIPNKYVLTVVISKRARQLFEELKFLKTIARDPLILAMEEIAQEKIAYGEGDDLED |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
| Pubmed ID | 28066333 |
| Domain | CDD:417484 |
| Functional Category | Others |
| Uniprot ID | B8E0X9 |
| ORF Length (Amino Acid) | 67 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1460478 | 1460681 | - | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 2 | 1280225 | 1280428 | - | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011661.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01189.19 | 1.0 | 2 | 4240.5 | same-strand | 16S rRNA methyltransferase RsmB/F |
| 2 | PF01029.20 | 1.0 | 2 | 4240.5 | same-strand | NusB family |
| 3 | PF17125.7 | 1.0 | 2 | 4240.5 | same-strand | N-terminal domain of 16S rRNA methyltransferase RsmF |
| 4 | PF04298.14 | 1.0 | 2 | 3551.0 | same-strand | Putative neutral zinc metallopeptidase |
| 5 | PF00551.21 | 1.0 | 2 | 2588.0 | same-strand | Formyl transferase |
| 6 | PF02911.20 | 1.0 | 2 | 2588.0 | same-strand | Formyl transferase, C-terminal domain |
| 7 | PF01327.23 | 1.0 | 2 | 2130.0 | same-strand | Polypeptide deformylase |
| 8 | PF17764.3 | 1.0 | 2 | 7.5 | same-strand | 3'DNA-binding domain (3'BD) |
| 9 | PF18074.3 | 1.0 | 2 | 7.5 | same-strand | Primosomal protein N C-terminal domain |
| 10 | PF18319.3 | 1.0 | 2 | 7.5 | same-strand | PriA DNA helicase Cys-rich region (CRR) domain |
| 11 | PF00625.23 | 1.0 | 2 | -19.0 | same-strand | Guanylate kinase |
| 12 | PF04025.14 | 1.0 | 2 | 614.0 | same-strand | Domain of unknown function (DUF370) |
| 13 | PF08340.13 | 1.0 | 2 | 888.5 | same-strand | Domain of unknown function (DUF1732) |
| 14 | PF03755.15 | 1.0 | 2 | 888.5 | same-strand | YicC-like family, N-terminal region |
| 15 | PF00590.22 | 1.0 | 2 | 1810.5 | opposite-strand | Tetrapyrrole (Corrin/Porphyrin) Methylases |
| 16 | PF02504.17 | 1.0 | 2 | 2677.0 | opposite-strand | Fatty acid synthesis protein |
++ More..