Result : EXP03061
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03061 |
| NCBI Accession ID | |
| Organism | Alistipes |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGCAAAGAAATGGCGTTGTACCGTATGCGGTTACATTCACGAAGGTCCCGAGGCACCCGACCAGTGCCCGATGTGCAAGGTAGGCAAGGAGAAGTTCGTGGAACTCGTTGAGGCCTAG |
| Sequence | MAKKWRCTVCGYIHEGPEAPDQCPMCKVGKEKFVELVEA |
| Source of smORF | Metagenomic Ribo-seq |
| Function | The ORF matches to the profile of cl00202. Profile Description: N/A. Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer. |
| Pubmed ID | 32601270 |
| Domain | CDD:412217 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 39 |
++ More..
| Conservation Analysis |
No. of Species: 29
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2229481 | 2229588 | + | NZ_CP071376.1 | Clostridium gasigenes |
| 2 | 5352165 | 5352281 | - | NZ_AP021875.1 | Desulfosarcina widdelii |
| 3 | 3612080 | 3612190 | + | NC_002939.5 | Geobacter sulfurreducens PCA |
| 4 | 3832005 | 3832121 | + | NZ_CP036259.1 | Sporomusa termitida |
| 5 | 3272872 | 3272985 | + | NZ_CP009788.1 | Geobacter pickeringii |
| 6 | 198502 | 198615 | + | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 7 | 697868 | 697969 | - | NC_012108.1 | Desulfobacterium autotrophicum HRM2 |
| 8 | 3154407 | 3154520 | + | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 9 | 3647255 | 3647365 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
| 10 | 1754514 | 1754627 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 11 | 2837676 | 2837807 | - | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 12 | 1782060 | 1782170 | - | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 13 | 4466197 | 4466328 | - | NZ_CP039126.1 | Blautia producta |
| 14 | 1627058 | 1627180 | - | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 15 | 2691919 | 2692035 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 16 | 3239902 | 3240039 | - | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 17 | 2005561 | 2005659 | - | NC_009464.1 | Methanocella arvoryzae MRE50 |
| 18 | 555383 | 555493 | - | NC_015578.1 | Treponema primitia ZAS-2 |
| 19 | 785628 | 785741 | + | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 20 | 2637836 | 2637952 | + | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 21 | 1247840 | 1247953 | - | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 22 | 194032 | 194136 | + | NZ_LN734822.1 | Methanobacterium formicicum |
| 23 | 1582384 | 1582491 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 24 | 2196488 | 2196592 | + | NZ_CP017768.1 | Methanobacterium subterraneum |
| 25 | 876173 | 876310 | + | NC_020127.1 | Lawsonia intracellularis N343 |
| 26 | 1275560 | 1275694 | - | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 27 | 477120 | 477233 | + | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 28 | 1427986 | 1428123 | - | NC_013203.1 | Lancefieldella parvulum DSM 20469 |
| 29 | 327354 | 327452 | + | NC_017034.1 | Methanocella conradii HZ254 |
++ More..